IEPINFMATMVRRVQLTDEDKSLLAEAAPWGKEIAPQMADTFYDYLGRDEEMNAILNATEGRIHRLHQTFVDWFYEMFTG
MDSWGKAYAERRWKIGLVHVRIGIGPQHVVPAMAVVVNAVRQKLREANKSEALSDALGKICMIDLAFIEQAYFEVSS
The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8h17:A | 157 | 157 | 1.0000 | 1.0000 | 1.0000 | 1.06e-117 | |
| 2 | 2w31:A | 152 | 144 | 0.2866 | 0.2961 | 0.3125 | 2.19e-14 | 2w31:B |
| 3 | 5ohe:F | 155 | 139 | 0.2803 | 0.2839 | 0.3165 | 1.23e-12 | 5ohe:A, 5ohe:B, 5ohe:C, 5ohe:D, 5ohe:E, 5ohe:G, 5ohe:H, 5ohf:A, 5ohf:B, 5ohf:C, 5ohf:D, 5ohf:E, 5ohf:F, 5ohf:G, 5ohf:H, 6otd:A |
| 4 | 1or4:A | 169 | 97 | 0.1783 | 0.1657 | 0.2887 | 4.15e-07 | 1or4:B, 1or6:A, 1or6:B |
| 5 | 6f77:A | 399 | 43 | 0.0955 | 0.0376 | 0.3488 | 3.1 | 6f77:C, 6f77:D, 6f77:E, 6f77:F |
| 6 | 7t1w:H2 | 217 | 45 | 0.0764 | 0.0553 | 0.2667 | 4.0 | 7t1w:H, 7t1w:H3, 7t1w:H4, 7t1w:H5, 7t1x:H, 7t1x:H2, 7t1x:H3, 7t1x:H4, 7t1x:H5 |
| 7 | 6s6b:D | 285 | 73 | 0.1146 | 0.0632 | 0.2466 | 7.0 | 6s6b:E, 6s6b:F, 6s6b:G, 6s8b:D, 6s8b:E, 6s8b:F, 6s8b:G, 6s8e:D, 6s8e:E, 6s8e:F, 6s8e:G, 6s91:D, 6s91:E, 6s91:F, 6s91:G, 6sh8:D, 6sh8:E, 6sh8:F, 6sh8:G, 6shb:D, 6shb:E, 6shb:F, 6shb:G, 6sic:D, 6sic:E, 6sic:F, 6sic:G |
| 8 | 2jgd:A | 812 | 29 | 0.0701 | 0.0135 | 0.3793 | 7.4 | 2jgd:B |
| 9 | 6vef:A | 844 | 29 | 0.0701 | 0.0130 | 0.3793 | 7.4 | 6vef:B |
umich.edu