IEDISAMKNGFIVVPFKLPDHKALPASLHFMFAKRHQSSNSNESDCLFLVNLPLLSNIEHMKKFVGQLCGKYDTVSHVEE
LLYNDEFGLHEVDLSALTSPRNTALLKFVDAASINNCWNALKKYSNLHAKHPNELFEWTYTTPSFTTFVNFYKPLDIDYL
KEDIHTHMAIFEQREAQAQEDVQSSIVDEDGFTLVVGKNTKSLNSIRKKILNKKAKKDFYRFQVRERKKQEI
The query sequence (length=232) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7d4i:RF | 241 | 239 | 1.0000 | 0.9627 | 0.9707 | 8.64e-172 | 7ajt:CN, 7aju:CN, 7d5t:RF, 7d63:RF, 6ke6:RF, 6lqp:RF, 6lqq:RF, 6lqr:RF, 6lqs:RF, 6lqt:RF, 5wyj:CA, 5wyk:CA, 6zqa:CN, 6zqb:CN, 6zqc:CN, 6zqd:CN, 6zqe:CN, 6zqf:CN |
2 | 8i0p:w | 434 | 65 | 0.0905 | 0.0484 | 0.3231 | 0.13 | 7abh:4, 7abi:4, 7evo:C, 8hk1:C, 8i0r:w, 8i0s:w, 8i0t:w, 8i0u:w, 7onb:N, 7q3l:9, 7q4o:9, 7q4p:9, 6qx9:A3, 8r08:9, 8rm5:9, 7vpx:C, 6y50:9 |
3 | 8hkx:AS5P | 204 | 94 | 0.0948 | 0.1078 | 0.2340 | 4.0 | 8hky:AS5P, 8hkz:AS5P, 8hl1:AS5P, 8hl2:AS5P, 8hl3:AS5P, 8hl4:AS5P, 8hl5:AS5P, 8wkp:AS5P, 8wq2:AS5P, 8wq4:AS5P |
4 | 6yx5:B | 339 | 64 | 0.0905 | 0.0619 | 0.3281 | 7.6 | |
5 | 7c79:D | 251 | 104 | 0.1336 | 0.1235 | 0.2981 | 9.3 | 6agb:D, 6ah3:D, 7c7a:D, 6w6v:D |