BioLiP

>protein
IDYSKLSKEVAYALRHAPWEYGLELDAEGWVDINQLLSSLHESEKWKKVSEHDLHVMIEKSDKKRYEISNGKIRALYGHS
IPQRIIKEQKCPPEVLYHGTARRFVKSIKEKGLQPQGRQYVHLSADVETALQVGKRRDIKPVLLIVNALEAWSEGIKFYL
GNDKVWLADAIPSKYIRF

The query sequence (length=178) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6e3a:A	180	178	0.9944	0.9833	0.9944	7.60e-130	6ede:A
2	8tfx:A	177	172	0.4045	0.4068	0.4186	6.41e-39	8tfy:A, 8tfz:A, 8tfz:B, 8tg5:A, 8tkb:A
3	7kw9:A	178	175	0.3933	0.3933	0.4000	2.94e-37
4	8tg3:A	187	172	0.3315	0.3155	0.3430	7.05e-27	8tg4:A
5	7yw2:A	206	179	0.2921	0.2524	0.2905	5.19e-17
6	7yw3:A	205	175	0.2809	0.2439	0.2857	1.29e-16
7	7yw4:A	120	93	0.1461	0.2167	0.2796	0.006
8	6ke6:RP	2052	46	0.0899	0.0078	0.3478	2.8
9	7suk:SP	2234	46	0.0899	0.0072	0.3478	3.1	6zqb:UT
10	7aju:UT	2313	46	0.0899	0.0069	0.3478	3.1	7ajt:UT, 6zqc:UT, 6zqd:UT, 6zqe:UT
11	6lqs:RP	2180	46	0.0899	0.0073	0.3478	3.4	7d63:RP, 6lqp:RP, 6lqq:RP, 6lqr:RP, 6lqt:RP, 6lqu:RP, 6lqv:RP
12	8wm6:g	219	35	0.0618	0.0502	0.3143	6.0	8wmv:g, 8wmw:g
13	5ue8:A	847	70	0.1124	0.0236	0.2857	6.1	5ue8:B, 1y8f:A
14	4qrn:A	352	41	0.0787	0.0398	0.3415	6.6	4inf:A, 4inf:B, 4inf:C, 4inf:D, 4qrn:B, 4qrn:C, 4qrn:D, 4qs5:A, 4qs5:B, 4qs5:C, 4qs5:D, 4qs6:A, 4qs6:B, 4qtg:A, 4qtg:B
15	8unf:A	187	78	0.1292	0.1230	0.2949	7.1	3u5z:A, 3u5z:K, 3u60:A, 8uh7:A, 8uk9:A, 8uk9:Q
16	3i0o:A	329	36	0.0618	0.0334	0.3056	9.7	3i0q:A, 3q2m:A

[Back]