IDPFTMSDLPCPPTNAERLHEFHRAIGAATPERPTPPPPELLRLRQTLLDEASAEVRAEIDHLLARQAAGEALSAGDLAP
LAHELADLLYVTYGALDQLGIDADAVFAEVHRANLSKASGLKPEGWRPADVRGVIERLQHA
The query sequence (length=141) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2yf3:C | 153 | 149 | 0.9929 | 0.9150 | 0.9396 | 5.01e-95 | 5hva:A, 5hva:B, 5hva:C, 5hva:D, 5hwu:A, 5hwu:B, 5hx1:A, 5hx1:C, 5hx1:B, 5hx1:D, 5hyl:A, 5hyl:C, 5hyl:B, 5hyl:D, 5hzz:A, 5hzz:B, 5hzz:C, 5hzz:D, 5i0j:A, 5i0j:D, 5i0j:B, 5i0j:C, 5i0m:A, 5i0m:D, 5i0m:B, 5i0m:C, 2yf3:A, 2yf3:B, 2yf3:D, 2yf3:E, 2yf3:F, 2yfc:A, 2yfc:B, 2yfc:C, 2yfc:D, 2yfd:A, 2yfd:B, 2yfd:C, 2yfd:D |
2 | 4df2:A | 404 | 75 | 0.1702 | 0.0594 | 0.3200 | 4.3 | 4m5p:A, 4qai:A, 4qai:B, 4qai:C, 4qai:D, 4qai:E, 4qai:F, 3tjl:A, 3upw:A |
3 | 2yxh:A | 114 | 82 | 0.1631 | 0.2018 | 0.2805 | 4.6 | 2yxh:B |
4 | 3tqo:A | 387 | 51 | 0.1348 | 0.0491 | 0.3725 | 6.0 | |
5 | 2ge3:A | 164 | 40 | 0.0993 | 0.0854 | 0.3500 | 7.9 | 2ge3:B, 2ge3:C |
6 | 8snd:A | 500 | 33 | 0.0851 | 0.0240 | 0.3636 | 8.6 | 8snc:A, 8sne:A, 7sp6:A, 7sp7:A, 7sp8:A, 7sp9:A, 7spa:A |
7 | 5fp1:A | 701 | 62 | 0.1135 | 0.0228 | 0.2581 | 9.0 | |
8 | 1cgm:E | 160 | 48 | 0.1206 | 0.1062 | 0.3542 | 9.7 |