IDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGR
The query sequence (length=44) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2mkd:A | 60 | 44 | 1.0000 | 0.7333 | 1.0000 | 2.05e-29 | 2mkn:A |
2 | 1zu1:A | 127 | 31 | 0.3409 | 0.1181 | 0.4839 | 1.13e-05 | |
3 | 6g90:T | 462 | 30 | 0.2500 | 0.0238 | 0.3667 | 0.13 | 7dco:u, 4dgw:A, 5nrl:T, 5zwm:u |
4 | 8idf:A | 459 | 24 | 0.2500 | 0.0240 | 0.4583 | 0.22 | |
5 | 3j79:J | 229 | 41 | 0.2955 | 0.0568 | 0.3171 | 2.3 | 3jbn:AJ, 3jbo:AJ, 3jbp:AJ, 8tpu:AJ, 5umd:J |
6 | 7txc:E | 84 | 17 | 0.1818 | 0.0952 | 0.4706 | 2.4 | |
7 | 8qzs:r | 114 | 27 | 0.1818 | 0.0702 | 0.2963 | 3.6 | 7abf:N, 7abg:N, 7abi:N, 8h6k:4N, 5o9z:N, 8q7n:r, 8qpe:r |
8 | 8bcx:D | 444 | 30 | 0.2273 | 0.0225 | 0.3333 | 5.8 | 8bcx:A, 8bcx:B, 8bcx:C |
9 | 3vrd:A | 174 | 21 | 0.1818 | 0.0460 | 0.3810 | 8.1 | |
10 | 5k3i:A | 661 | 39 | 0.3182 | 0.0212 | 0.3590 | 8.8 | 5k3i:B, 5k3i:C, 5k3i:D, 5k3i:E, 5k3i:F, 5k3i:G, 5k3i:H |
11 | 3o2k:A | 429 | 26 | 0.2045 | 0.0210 | 0.3462 | 9.8 | |
12 | 8q1b:D | 245 | 29 | 0.2500 | 0.0449 | 0.3793 | 9.9 | 8q1b:O |