IAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEM
KQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
The query sequence (length=144) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4day:A | 144 | 144 | 1.0000 | 1.0000 | 1.0000 | 1.13e-104 | |
2 | 1a76:A | 315 | 84 | 0.1319 | 0.0603 | 0.2262 | 0.44 | 1a77:A |
3 | 6hiv:AY | 340 | 50 | 0.1181 | 0.0500 | 0.3400 | 3.0 | 7aoi:AY, 6hix:AY, 6yxx:AY, 6yxy:AY |
4 | 1w6f:A | 273 | 48 | 0.0833 | 0.0440 | 0.2500 | 4.6 | 1w6f:B, 1w6f:C, 1w6f:D |
5 | 8a56:B | 539 | 40 | 0.0972 | 0.0260 | 0.3500 | 7.1 | 8a56:A |
6 | 8k9e:F | 397 | 33 | 0.0903 | 0.0327 | 0.3939 | 8.1 | 8k9f:F, 8x2j:F |