BioLiP

>protein
IAGRIVVLDPGHNGANDSSINNQVPDGRGGTKSCQTSGTATDGGYPEHTFTWNTVLLIRQQLTQLGVRTAMTRGDDNKLG
PCIDKRAEIENSYNPDAVVSIHADGGPAGGHGFHVNYSNPPVNAVQGEPTLRFAKTMRDSLQAAGLTPATYIGTGGLYGR
SDLAGLNLAQHPKVLVELGNMKNAQDSAMMTSPEGRSKYAQAVVQGIVAYLSGT

The query sequence (length=214) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7ago:A	214	214	1.0000	1.0000	1.0000	4.07e-160	7agl:A
2	7agm:A	218	211	0.6822	0.6697	0.6919	1.66e-107	7agm:B
3	4m6g:A	214	212	0.6495	0.6495	0.6557	1.33e-106	4lq6:A, 4m6i:A, 4m6i:B
4	5j72:A	638	194	0.2477	0.0831	0.2732	7.65e-10	5j72:B
5	7tj4:B	176	215	0.2523	0.3068	0.2512	2.84e-07	7tj4:D
6	5emi:A	180	210	0.2477	0.2944	0.2524	7.41e-06
7	8c2o:A	228	242	0.2477	0.2325	0.2190	1.11e-05	8c2o:B
8	8c0j:A	200	218	0.2477	0.2650	0.2431	1.90e-05	8c0j:C
9	1jwq:A	179	210	0.2523	0.3017	0.2571	1.15e-04
10	7rag:B	197	223	0.2103	0.2284	0.2018	1.94e-04
11	4rn7:A	186	208	0.2056	0.2366	0.2115	8.60e-04
12	3ne8:A	226	237	0.2243	0.2124	0.2025	0.014
13	4ztc:A	385	47	0.0794	0.0442	0.3617	0.13	1o61:A, 1o61:B, 1o69:A, 1o69:B
14	4bin:A	348	241	0.2336	0.1437	0.2075	0.13
15	7b3n:B	170	206	0.2430	0.3059	0.2524	0.19	7b3n:A, 7b3n:C, 7b3n:D, 7b3n:E
16	4gfr:A	529	97	0.0935	0.0378	0.2062	6.7	8i5j:A, 8i5j:B, 8i5k:A, 1zu0:A
17	7ebi:A	537	96	0.0981	0.0391	0.2188	9.3	7ebm:A, 6lzq:A, 6lzt:A, 6lzu:A, 6lzv:A, 6lzw:A
18	7dnm:A	336	70	0.0981	0.0625	0.3000	9.5	7dnm:P, 7dnn:A, 7dnn:P

[Back]