BioLiP

>protein
IAGMVVFIDPGHTSTNSGYPEHTFTWETGLRLRAALNALGVRTALSRGNDGPCVDERANMANALRPNAIVSLHADGGPAS
GRGFHVNYSAPPLNAIQAGPSVQFARIMRDQLQASGIPKANYIGQDGLYGRSDLAGLNLAQYPSILVELGNMKNPADSAL
MESAEGRQKYANALVRGVAGFLATQ

The query sequence (length=185) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4m6g:A	214	214	1.0000	0.8645	0.8645	4.49e-128	4lq6:A, 4m6i:A, 4m6i:B
2	7agm:A	218	214	0.7784	0.6606	0.6729	1.30e-101	7agm:B
3	7ago:A	214	212	0.6324	0.5467	0.5519	8.69e-82	7agl:A
4	5j72:A	638	177	0.2649	0.0768	0.2768	5.34e-10	5j72:B
5	5emi:A	180	189	0.2865	0.2944	0.2804	3.16e-08
6	8c0j:A	200	198	0.3081	0.2850	0.2879	5.26e-07	8c0j:C
7	7tj4:B	176	192	0.2432	0.2557	0.2344	7.12e-07	7tj4:D
8	4rn7:A	186	192	0.2432	0.2419	0.2344	2.05e-06
9	7rag:B	197	192	0.2162	0.2030	0.2083	7.07e-05
10	4bin:A	348	215	0.2595	0.1379	0.2233	1.61e-04
11	8c2o:A	228	220	0.2595	0.2105	0.2182	3.28e-04	8c2o:B
12	1jwq:A	179	187	0.2324	0.2402	0.2299	6.79e-04
13	7b3n:B	170	155	0.2378	0.2588	0.2839	0.082	7b3n:A, 7b3n:C, 7b3n:D, 7b3n:E
14	3ne8:A	226	221	0.2865	0.2345	0.2398	0.14
15	3be7:A	398	49	0.0919	0.0427	0.3469	4.1	3be7:E, 3be7:B, 3be7:D, 3be7:C, 3be7:F, 3be7:G, 3be7:H, 3dug:A, 3dug:B, 3dug:C, 3dug:D, 3dug:E, 3dug:F, 3dug:G, 3dug:H
16	2xdq:A	425	66	0.0973	0.0424	0.2727	5.9
17	6u6a:A	306	76	0.1243	0.0752	0.3026	6.6

[Back]