IAETLTEKHTLGIEKVVATDSWRVGITSREKKLERINISAEISRRIQDEAIAYARNKGIPYLPGINGIAWKLLRLKWLGY
TDQINVVMRTVPAEWRDFLTQIMENTQMESMYSELRKVR
The query sequence (length=119) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6v7b:A | 119 | 119 | 1.0000 | 1.0000 | 1.0000 | 8.81e-85 | 6v7b:B, 6v7b:C, 6v7b:D, 6v7b:E, 6v7b:F, 6v7b:G, 6v7b:H, 6v7b:I, 6v7b:J, 6v7b:K, 6v7b:L, 6v7b:M, 6v7b:N, 6v7b:O, 6v7b:P, 6v7b:Q, 6v7b:R, 6v7b:S, 6v7b:T, 6v7b:U, 6v7b:V, 6v7b:W |
2 | 8pth:C | 178 | 76 | 0.1597 | 0.1067 | 0.2500 | 0.16 | 8ptj:C |
3 | 8fkp:SZ | 160 | 22 | 0.0924 | 0.0688 | 0.5000 | 0.34 | 8fkq:SZ, 8fkr:SZ, 8fks:SZ, 8fkt:SZ, 8fku:SZ, 8fkv:SZ, 8fkw:SZ, 8fkx:SZ, 8fky:SZ |
4 | 1wa3:D | 203 | 71 | 0.1513 | 0.0887 | 0.2535 | 0.41 | 1wa3:A, 1wa3:B, 1wa3:C, 1wa3:E, 1wa3:F |
5 | 4rzq:A | 422 | 86 | 0.2101 | 0.0592 | 0.2907 | 0.84 | 4mv6:A, 4mv7:A, 4mv9:A |
6 | 1kp3:A | 439 | 38 | 0.1176 | 0.0319 | 0.3684 | 1.9 | 1k97:A, 1kp2:A |
7 | 5ojg:A | 260 | 55 | 0.1597 | 0.0731 | 0.3455 | 3.1 | 5ojg:B, 5oji:A, 5oji:B |
8 | 8p5d:SH0 | 163 | 50 | 0.1176 | 0.0859 | 0.2800 | 7.2 | 8p60:SH0, 8p60:RH0, 7qca:SH0 |
9 | 3x1l:H | 297 | 26 | 0.0840 | 0.0337 | 0.3846 | 7.7 |