IAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKK
ATVTLEDHLACKCET
The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4hqu:A | 95 | 95 | 1.0000 | 1.0000 | 1.0000 | 1.43e-65 | 4hqx:A |
2 | 1kat:V | 99 | 63 | 0.1895 | 0.1818 | 0.2857 | 3.01e-05 | 6d3o:A, 6d3o:B, 4glu:D, 1kat:W, 4kzn:A, 3qtk:A, 3qtk:D, 3qtk:F, 6v7k:B, 1vpp:V, 1vpp:W, 6z13:W, 6z3f:W, 6zbr:W, 6zcd:W |
3 | 8ud1:1P | 342 | 29 | 0.0842 | 0.0234 | 0.2759 | 7.6 | 5gpn:p, 5gup:L, 8ueo:1P, 8uep:1P, 8ueq:1P, 8uer:1P, 8ues:1P, 8uet:1P, 8ueu:1P, 8uev:1P, 8uew:1P, 8uex:1P, 8uey:1P, 8uez:1P, 8ugh:1P, 8ugi:1P, 8ugj:1P, 8ugn:1P, 8ugn:5P, 8ugr:1P, 8ugr:5P, 7v2c:J, 7v2e:J, 7v2h:J, 7v2k:J, 7v2r:J, 7v31:J, 7v33:J, 7vb7:J, 7vbn:J, 7vbz:J, 7vxp:J, 7vy8:J, 7vyf:J, 7vyn:J, 7vzv:J, 7vzw:J, 7w0r:J, 7w0y:J, 7w1t:J, 7w1u:J, 7w1v:J, 7w1z:J, 7w20:J, 7w2r:J, 7w2u:J, 7w2y:J, 7w31:J, 7w32:J, 7w35:J, 7w4c:J, 7w4d:J, 7w4e:J, 7w4f:J, 7w4g:J |