BioLiP

>protein
HYTFPKVWANSGTTADWQYVRRADNWQNNGFVDNVNSQQIRCFQSTHSPAQSTLSVAAGTTITYGAAPSVYHPGPMQFYL
ARVPDGQDINSWTGEGAVWFKIYHEQPTFGSQLTWSSNGKSSFPVKIPSCIKSGSYLLRAEHIGLHVAQSSGAAQFYISC
AQLSITGGGSTEPGANYKVSFPGAYKASDPGILININYPVPTSYKNPGPSVFTC

The query sequence (length=214) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4qi8:A	214	214	1.0000	1.0000	1.0000	1.37e-160	4qi8:B
2	3eii:A	208	214	0.7290	0.7500	0.7290	1.35e-111	3eii:B, 3eii:C, 3eii:D, 3eja:A, 3eja:B, 3eja:C, 3eja:D
3	8b7p:AAA	213	216	0.4720	0.4742	0.4676	1.28e-61	8b7p:BBB, 8b7p:CCC, 8b7p:DDD
4	7exk:A	217	218	0.4252	0.4194	0.4174	2.40e-47	7exk:B, 7exk:C, 7exk:D, 7exk:E, 7exk:F
5	4b5q:A	217	221	0.4626	0.4562	0.4480	7.69e-46	4b5q:B
6	4eir:A	223	206	0.3972	0.3812	0.4126	8.57e-36	4eir:B, 7t5c:A, 7t5c:B, 7t5d:A, 7t5d:B, 7t5e:A, 7t5e:B, 5tkf:A, 5tkf:C, 5tkf:B, 5tkf:D, 5tkg:A, 5tkg:B, 5tkh:A, 5tkh:B, 5tki:A, 5tki:B
7	4d7u:A	227	240	0.4252	0.4009	0.3792	8.29e-33	4d7u:B, 4d7v:A, 4d7v:B
8	5foh:A	218	228	0.4019	0.3945	0.3772	6.61e-32
9	4eis:A	225	202	0.3785	0.3600	0.4010	5.91e-31	4eis:B
10	6rs6:A	221	207	0.3598	0.3484	0.3720	2.21e-28	6rs9:A
11	5ufv:A	228	202	0.3411	0.3202	0.3614	4.59e-25	5ufv:B, 5ufv:C, 5ufv:D, 5ufv:E, 5ufv:F
12	5nns:A	225	170	0.2897	0.2756	0.3647	1.02e-21	5nns:B
13	5o2w:A	248	195	0.3224	0.2782	0.3538	1.05e-19	5o2x:A
14	8b4g:AAA	228	193	0.3178	0.2982	0.3523	2.03e-17	7pu1:AAA, 7pu1:BBB, 7pz3:A, 7pz4:A, 7pz5:A, 7pz6:A, 7pz7:A, 7pz8:A, 7q1k:A, 2yet:A, 2yet:B, 3zud:A
15	7ova:DDD	231	193	0.3037	0.2814	0.3368	3.09e-17	7ova:AAA, 7ova:BBB, 7ova:CCC
16	5acf:A	235	228	0.3458	0.3149	0.3246	4.35e-17	5acg:A, 5ach:A, 5aci:A, 5acj:A, 8e1w:A, 5n04:A, 5n05:A, 7nim:A, 7nin:A, 5nkw:A, 5nln:A, 5nlo:A, 5nlp:A, 5nlq:A, 5nlr:A, 5nls:A, 7pqr:A, 7ptz:AAA, 7pxi:A, 7pxj:A, 7pxk:A, 7pxl:A, 7pxm:A, 7pxn:A, 7pxr:A, 7pxs:A, 7pxt:A, 7pxu:A, 7pxv:A, 7pxw:A, 7pyd:A, 7pye:A, 7pyf:A, 7pyg:A, 7pyh:A, 7pyi:A, 7pyl:A, 7pym:A, 7pyn:A, 7pyo:A, 7pyp:A, 7pyq:A, 7pyu:A, 7pyw:A, 7pyx:A, 7pyy:A, 7pyz:A, 7pz0:A, 6ydg:A
17	7ntl:A	220	192	0.2991	0.2909	0.3333	1.61e-16
18	2vtc:A	228	191	0.2664	0.2500	0.2984	5.23e-14	2vtc:B
19	5nlt:B	227	237	0.3178	0.2996	0.2869	1.60e-13	5nlt:A, 5nlt:C, 5nlt:D, 5nlt:E, 5nlt:F, 6ydc:A, 6ydc:B, 6ydc:C, 6ydc:D, 6ydd:A, 6ydd:B, 6yde:A, 6ydf:A, 6ydf:B
20	7a8v:A	230	106	0.1963	0.1826	0.3962	2.90e-13
21	5x6a:A	229	193	0.2897	0.2707	0.3212	5.39e-13	6h1z:A, 6h1z:B, 6ha5:A, 6ha5:B, 6haq:A, 6haq:B, 5x6a:B
22	7vfc:A	228	195	0.2991	0.2807	0.3282	5.60e-12
23	6rxt:UQ	789	45	0.0701	0.0190	0.3333	2.1	6rxu:UQ, 6rxv:UQ, 6rxx:UQ, 6rxy:UQ, 6rxz:UQ
24	5fks:A	731	97	0.1215	0.0356	0.2680	9.7

[Back]