HVVYIGKKPVMNYVLAVITQFHEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDDVDVKEIKIGTEELPTADGRTTNTST
IEIVLARKT
The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2z7c:A | 89 | 89 | 1.0000 | 1.0000 | 1.0000 | 3.36e-60 | 2z7c:B, 2z7c:C |
2 | 3wbm:A | 86 | 88 | 0.5393 | 0.5581 | 0.5455 | 3.50e-28 | 3wbm:B, 3wbm:C |
3 | 7lu4:B | 977 | 77 | 0.2809 | 0.0256 | 0.3247 | 3.1 | |
4 | 6uel:A | 1333 | 28 | 0.1573 | 0.0105 | 0.5000 | 3.2 | 6uel:B |
5 | 5dou:D | 1430 | 28 | 0.1573 | 0.0098 | 0.5000 | 3.2 | 5dou:A, 5dou:B, 5dou:C, 6w2j:A |
6 | 6w2j:B | 1364 | 28 | 0.1573 | 0.0103 | 0.5000 | 3.3 |