HVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVDTEFQHPCFLR
GQEQLLENIKRKV
The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7dcj:B | 110 | 103 | 1.0000 | 0.8455 | 0.9029 | 1.56e-64 | 5d5u:B, 5d5v:B, 5d5v:D, 7dcj:A, 7dcs:A, 7dcs:B, 7dcs:C, 7dcs:D, 7dcs:E, 7dcs:F, 7dct:A, 7dct:B, 7dct:C, 7dct:D, 7dct:E, 7dct:F, 5hdn:A, 5hdn:C |
2 | 7dcu:A | 101 | 94 | 0.7312 | 0.6733 | 0.7234 | 6.91e-45 | 7dci:A, 7dcu:C |
3 | 5d8k:B | 106 | 106 | 0.7204 | 0.6321 | 0.6321 | 1.05e-42 | 5d8l:B, 5d8l:D, 5d8l:F, 5d8l:H, 7dcu:B |
4 | 1fyk:A | 88 | 70 | 0.4301 | 0.4545 | 0.5714 | 3.23e-24 | 3hts:B |
5 | 5d5x:B | 99 | 97 | 0.4516 | 0.4242 | 0.4330 | 9.12e-23 | 5d5w:B, 5d5x:E |
6 | 3e8s:A | 220 | 33 | 0.1505 | 0.0636 | 0.4242 | 0.33 | |
7 | 1u2g:B | 359 | 36 | 0.1075 | 0.0279 | 0.2778 | 0.75 | 2fr8:A |
8 | 1f8g:A | 382 | 36 | 0.1075 | 0.0262 | 0.2778 | 0.76 | 1f8g:B, 1f8g:C, 1f8g:D, 2frd:A, 2frd:B, 2fsv:A, 1hzz:A, 1l7e:A, 1l7e:D, 1nm5:A, 1nm5:B, 2oo5:A, 2oo5:B, 2oor:A, 2oor:B, 1ptj:A, 1u28:A, 1u28:B, 1u2d:A, 1u2d:B, 1u2g:A, 1xlt:A, 1xlt:B, 1xlt:D, 1xlt:E, 1xlt:H, 1xlt:G |
9 | 7b0c:A | 144 | 55 | 0.1720 | 0.1111 | 0.2909 | 0.83 | 7b0c:B, 5n07:A |
10 | 7yni:A | 566 | 31 | 0.1183 | 0.0194 | 0.3548 | 2.5 | |
11 | 7sla:A | 585 | 31 | 0.1183 | 0.0188 | 0.3548 | 2.5 | 7sl8:A |
12 | 7wmv:A | 602 | 31 | 0.1183 | 0.0183 | 0.3548 | 2.5 | |
13 | 3aej:A | 387 | 20 | 0.1183 | 0.0284 | 0.5500 | 3.0 | 3aej:D, 3aej:B, 3aej:C, 3ael:A, 3ael:D, 3ael:B, 3ael:C, 3aem:A, 3aem:D, 3aem:B, 3aem:C, 3aen:A, 3aen:D, 3aen:B, 3aen:C, 3aeo:A, 3aeo:D, 3aeo:B, 3aeo:C, 3aep:A, 3aep:D, 3aep:B, 3aep:C |
14 | 4ueg:B | 249 | 93 | 0.2688 | 0.1004 | 0.2688 | 3.5 | 4ueg:A |
15 | 2y6p:B | 233 | 63 | 0.2688 | 0.1073 | 0.3968 | 3.8 | 2y6p:A, 2y6p:C |
16 | 8fny:A | 497 | 41 | 0.1505 | 0.0282 | 0.3415 | 4.4 | 8fny:C, 8fo6:A, 8gm5:A, 7shq:A |
17 | 7oya:a1 | 147 | 46 | 0.1720 | 0.1088 | 0.3478 | 6.1 | 7oyb:a1 |
18 | 8b9z:E | 214 | 18 | 0.0860 | 0.0374 | 0.4444 | 7.5 | 8ba0:E, 8esw:V2, 8esz:V2 |