HTIFSSLEVNGVNQGLGEGVRVPTYNGPIEDVTSASIACNGSPNTVASTSKVITVQAGTNVTAIWRYMLSTTGDSPADVM
DSSHKGPTIAYLKKVDNAATASGVGNGWFKIQQDGMDSSGVWGTERVINGKGRHSIKIPECIAPGQYLLRAEMIALHAAS
NYPGAQFYMECAQLNVVGGTGAKTPSTVSFPGAYSGSDPGVKISIYWPPVTAYTVPGPSVFTC
The query sequence (length=223) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 4eir:A | 223 | 223 | 1.0000 | 1.0000 | 1.0000 | 2.23e-166 | 4eir:B, 7t5c:A, 7t5c:B, 7t5d:A, 7t5d:B, 7t5e:A, 7t5e:B, 5tkf:A, 5tkf:C, 5tkf:B, 5tkf:D, 5tkg:A, 5tkg:B, 5tkh:A, 5tkh:B, 5tki:A, 5tki:B |
| 2 | 5foh:A | 218 | 223 | 0.5740 | 0.5872 | 0.5740 | 4.60e-85 | |
| 3 | 4d7u:A | 227 | 231 | 0.4843 | 0.4758 | 0.4675 | 3.51e-63 | 4d7u:B, 4d7v:A, 4d7v:B |
| 4 | 6rs6:A | 221 | 226 | 0.4484 | 0.4525 | 0.4425 | 6.36e-56 | 6rs9:A |
| 5 | 5acf:A | 235 | 232 | 0.3901 | 0.3702 | 0.3750 | 2.48e-42 | 5acg:A, 5ach:A, 5aci:A, 5acj:A, 8e1w:A, 5n04:A, 5n05:A, 7nim:A, 7nin:A, 5nkw:A, 5nln:A, 5nlo:A, 5nlp:A, 5nlq:A, 5nlr:A, 5nls:A, 7pqr:A, 7ptz:AAA, 7pxi:A, 7pxj:A, 7pxk:A, 7pxl:A, 7pxm:A, 7pxn:A, 7pxr:A, 7pxs:A, 7pxt:A, 7pxu:A, 7pxv:A, 7pxw:A, 7pyd:A, 7pye:A, 7pyf:A, 7pyg:A, 7pyh:A, 7pyi:A, 7pyl:A, 7pym:A, 7pyn:A, 7pyo:A, 7pyp:A, 7pyq:A, 7pyu:A, 7pyw:A, 7pyx:A, 7pyy:A, 7pyz:A, 7pz0:A, 6ydg:A |
| 6 | 4eis:A | 225 | 205 | 0.3812 | 0.3778 | 0.4146 | 3.26e-42 | 4eis:B |
| 7 | 8b7p:AAA | 213 | 229 | 0.3857 | 0.4038 | 0.3755 | 5.31e-40 | 8b7p:BBB, 8b7p:CCC, 8b7p:DDD |
| 8 | 3eii:A | 208 | 203 | 0.3587 | 0.3846 | 0.3941 | 1.67e-36 | 3eii:B, 3eii:C, 3eii:D, 3eja:A, 3eja:B, 3eja:C, 3eja:D |
| 9 | 4qi8:A | 214 | 206 | 0.3812 | 0.3972 | 0.4126 | 8.93e-36 | 4qi8:B |
| 10 | 5nns:A | 225 | 206 | 0.3901 | 0.3867 | 0.4223 | 1.70e-35 | 5nns:B |
| 11 | 5nlt:B | 227 | 234 | 0.3543 | 0.3480 | 0.3376 | 5.02e-33 | 5nlt:A, 5nlt:C, 5nlt:D, 5nlt:E, 5nlt:F, 6ydc:A, 6ydc:B, 6ydc:C, 6ydc:D, 6ydd:A, 6ydd:B, 6yde:A, 6ydf:A, 6ydf:B |
| 12 | 7exk:A | 217 | 204 | 0.3543 | 0.3641 | 0.3873 | 2.85e-28 | 7exk:B, 7exk:C, 7exk:D, 7exk:E, 7exk:F |
| 13 | 4b5q:A | 217 | 204 | 0.3274 | 0.3364 | 0.3578 | 9.03e-25 | 4b5q:B |
| 14 | 8b4g:AAA | 228 | 146 | 0.2422 | 0.2368 | 0.3699 | 1.11e-24 | 7pu1:AAA, 7pu1:BBB, 7pz3:A, 7pz4:A, 7pz5:A, 7pz6:A, 7pz7:A, 7pz8:A, 7q1k:A, 2yet:A, 2yet:B, 3zud:A |
| 15 | 7a8v:A | 230 | 145 | 0.2332 | 0.2261 | 0.3586 | 1.05e-23 | |
| 16 | 7ntl:A | 220 | 172 | 0.2601 | 0.2636 | 0.3372 | 3.68e-23 | |
| 17 | 5x6a:A | 229 | 145 | 0.2377 | 0.2314 | 0.3655 | 6.96e-22 | 6h1z:A, 6h1z:B, 6ha5:A, 6ha5:B, 6haq:A, 6haq:B, 5x6a:B |
| 18 | 5ufv:A | 228 | 219 | 0.3004 | 0.2939 | 0.3059 | 1.25e-21 | 5ufv:B, 5ufv:C, 5ufv:D, 5ufv:E, 5ufv:F |
| 19 | 7ova:DDD | 231 | 145 | 0.2152 | 0.2078 | 0.3310 | 2.26e-21 | 7ova:AAA, 7ova:BBB, 7ova:CCC |
| 20 | 7vfc:A | 228 | 196 | 0.2960 | 0.2895 | 0.3367 | 4.02e-21 | |
| 21 | 5o2w:A | 248 | 143 | 0.2422 | 0.2177 | 0.3776 | 4.45e-21 | 5o2x:A |
| 22 | 2vtc:A | 228 | 196 | 0.2511 | 0.2456 | 0.2857 | 6.06e-19 | 2vtc:B |
| 23 | 6jzb:A | 251 | 31 | 0.0628 | 0.0558 | 0.4516 | 2.2 | |
| 24 | 6zu5:SG0 | 218 | 52 | 0.0448 | 0.0459 | 0.1923 | 2.4 | |
| 25 | 4tqm:A | 402 | 58 | 0.0762 | 0.0423 | 0.2931 | 2.9 | |
| 26 | 2n2h:B | 125 | 47 | 0.0717 | 0.1280 | 0.3404 | 6.9 | |
| 27 | 6tmh:B | 479 | 58 | 0.0807 | 0.0376 | 0.3103 | 7.7 | 6tmh:D, 6tmk:B2, 6tmk:D2, 6tmk:B1, 6tmk:D1 |
| 28 | 8rpl:B | 630 | 95 | 0.1166 | 0.0413 | 0.2737 | 9.7 | 8rpk:A, 8rpk:B, 8rpk:C, 8rpk:D, 8rpl:A, 8rpl:C, 8rpl:D |
umich.edu