HPGLVPRDKLKLHCEFCRFHWVQDTLVVRCAAHPKEHNQREIWLEPTWTWGKQQ
The query sequence (length=54) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7aih:W | 54 | 54 | 1.0000 | 1.0000 | 1.0000 | 3.51e-36 | 7ane:W |
2 | 6hiv:A9 | 53 | 51 | 0.5926 | 0.6038 | 0.6275 | 6.20e-19 | 6hix:A9 |
3 | 4v61:B6 | 38 | 35 | 0.2407 | 0.3421 | 0.3714 | 0.20 | 6xyw:AE |
4 | 7nhk:8 | 38 | 35 | 0.2407 | 0.3421 | 0.3714 | 1.9 | 5myj:B8, 6o8w:6, 6o8x:6, 6o8y:6, 6o8z:6, 6o90:6, 7p7q:8, 7p7r:8, 7p7s:8, 7p7t:8, 7p7u:8, 6w6p:6, 6wu9:6 |
5 | 6v7z:F | 117 | 45 | 0.2407 | 0.1111 | 0.2889 | 2.6 | |
6 | 7r89:B | 529 | 14 | 0.1481 | 0.0151 | 0.5714 | 4.1 | |
7 | 7r8b:B | 564 | 14 | 0.1481 | 0.0142 | 0.5714 | 4.2 | |
8 | 7bzc:A | 535 | 14 | 0.1296 | 0.0131 | 0.5000 | 4.5 | 7bzb:A |
9 | 3hqi:A | 294 | 24 | 0.2222 | 0.0408 | 0.5000 | 4.6 | 7d3d:A, 7d3d:B, 6f8f:D, 6f8g:A, 6f8g:C, 6f8g:D, 6f8g:B, 3hqh:A, 3hqi:B, 3hql:A, 3hql:B, 3hqm:A, 3hqm:B, 3hsv:A, 3hsv:B, 3hu6:A, 3hu6:B, 6i41:A, 6i5p:A, 6i5p:C, 6i5p:E, 6i5p:G, 6i68:A, 6i68:C, 6i68:E, 6i68:G, 6i7a:A, 6i7a:C, 6i7a:E, 6i7a:G, 3ivb:A, 3ivq:A, 3ivq:B, 3ivv:A, 7klz:A, 7klz:B, 7kpk:A, 7lin:A, 7lio:A, 7lio:B, 4o1v:A |
10 | 4x8r:A | 304 | 23 | 0.1852 | 0.0329 | 0.4348 | 7.8 | 4x8r:B |