HNKKFDRSEHVYRNDSFLELIKDAVRFFSGTPVHSLPPPERFQGAGVYALYYTGHYSLYDEYSRINRKAYNLPIYVGKAV
PAGWRQSRISDHETRAGSELSNRIREHGRNIAKTSNLDLCDFSCRFVIFEATGSDMISTVQAALIKIYKPLWNTVVDGFG
NHTPGAGRFAQAKSDWDVIHPGREWAEKCTGVHSEPYFIEERIKQYFSKSNFT
The query sequence (length=213) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3mx4:A | 213 | 213 | 1.0000 | 1.0000 | 1.0000 | 6.55e-163 | 3mx4:D, 3mx4:F, 3mx4:H, 3mx4:C, 3mx4:G, 3mx4:B, 3mx4:E, 3nic:A, 3nic:H, 3nic:C, 3nic:G, 3nic:B, 3nic:D, 3nic:E, 3nic:F |
2 | 7c3o:A | 316 | 147 | 0.1643 | 0.1108 | 0.2381 | 1.4 | |
3 | 2yk0:A | 698 | 60 | 0.0845 | 0.0258 | 0.3000 | 3.3 | 2xu0:A |
4 | 6eon:A | 754 | 103 | 0.1080 | 0.0305 | 0.2233 | 4.6 | |
5 | 3wbb:A | 297 | 60 | 0.0798 | 0.0572 | 0.2833 | 6.8 | 3wbb:B, 3wbb:C, 3wbf:A, 3wbf:B, 3wbf:C |
6 | 2i4n:B | 442 | 112 | 0.1408 | 0.0679 | 0.2679 | 8.6 | 2i4m:B, 2i4m:C, 2i4n:A, 2i4n:C, 2i4o:A, 2i4o:B, 2i4o:C |