HNKKFDRSEHVYRNDSFLELIKDAVRFFSGTPVHSLPPPERFQGAGVYALYYTGHYSLYDEYSRINRKAYNLPIYVGKAV
PAGWRQSRISDHETRAGSELSNRIREHGRNIAKTSNLDLCDFSCRFVIFEATGSDMISTVQAALIKIYKPLWNTVVDGFG
NHTPGAGRFAQAKSDWDVIHPGREWAEKCTGVHSEPYFIEERIKQYFS
The query sequence (length=208) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3mx4:A | 213 | 208 | 1.0000 | 0.9765 | 1.0000 | 4.09e-159 | 3mx4:D, 3mx4:F, 3mx4:H, 3mx4:C, 3mx4:G, 3mx4:B, 3mx4:E, 3nic:A, 3nic:H, 3nic:C, 3nic:G, 3nic:B, 3nic:D, 3nic:E, 3nic:F |
2 | 7c3o:A | 316 | 147 | 0.1683 | 0.1108 | 0.2381 | 1.3 | |
3 | 2yk0:A | 698 | 60 | 0.0865 | 0.0258 | 0.3000 | 2.7 | 2xu0:A |
4 | 6eon:A | 754 | 103 | 0.1106 | 0.0305 | 0.2233 | 4.0 | |
5 | 2i4n:B | 442 | 112 | 0.1442 | 0.0679 | 0.2679 | 8.6 | 2i4m:B, 2i4m:C, 2i4n:A, 2i4n:C, 2i4o:A, 2i4o:B, 2i4o:C |