HNKKFDRSEHVYRNDSFLELIKDAVRFFSGTPVHSLPPPERFQGAGVFALYYTGHYSLYDEYSRINRKAYNLPIYVGKAV
PAGWRQSRISDHETRAGSELSNRIREHGRNIAKTSNLDLCDFSCRFVIFEATGSDMISTVEAALIKIYKPLWNTVVDGFG
NHTPGAGRFAQAKSDWDVIHPGREWAEKCTGVHSEPYFIEERIKQYFSKS
The query sequence (length=210) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3mx4:A | 213 | 210 | 0.9905 | 0.9765 | 0.9905 | 3.09e-159 | 3mx4:D, 3mx4:F, 3mx4:H, 3mx4:C, 3mx4:G, 3mx4:B, 3mx4:E, 3nic:A, 3nic:H, 3nic:C, 3nic:G, 3nic:B, 3nic:D, 3nic:E, 3nic:F |
2 | 7c3o:A | 316 | 147 | 0.1667 | 0.1108 | 0.2381 | 1.6 | |
3 | 6eon:A | 754 | 103 | 0.1095 | 0.0305 | 0.2233 | 5.3 | |
4 | 2yk0:A | 698 | 60 | 0.0810 | 0.0244 | 0.2833 | 8.0 | 2xu0:A |
5 | 3wbb:A | 297 | 58 | 0.0810 | 0.0572 | 0.2931 | 9.2 | 3wbb:B, 3wbb:C, 3wbf:A, 3wbf:B, 3wbf:C |