HMTSPFKLPDESPSWTEWRLHNDETQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQ
IGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQEMLQMA
The query sequence (length=121) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6bjv:A | 148 | 122 | 0.9008 | 0.7365 | 0.8934 | 1.19e-80 | 6bjg:A, 6bjg:B, 6bjh:A, 6bjh:B, 6bjv:B, 4j39:A, 4j5v:A, 4jgn:A, 4jk0:D, 4jnx:A, 4jnx:D, 4knq:A, 4kq0:A, 4kq0:D, 4ktg:A, 1r9f:A, 1rpu:A, 1rpu:B |
2 | 6gdr:A | 256 | 64 | 0.1488 | 0.0703 | 0.2812 | 2.8 | |
3 | 5ta1:A | 627 | 44 | 0.1157 | 0.0223 | 0.3182 | 3.3 | 5ta0:A, 5ta0:B, 5ta5:A, 5ta5:B |
4 | 1e5q:A | 449 | 13 | 0.0744 | 0.0200 | 0.6923 | 3.8 | 1e5q:B, 1e5q:C, 1e5q:D, 1e5q:E, 1e5q:F, 1e5q:G, 1e5q:H |
5 | 8u6b:A | 532 | 30 | 0.0909 | 0.0207 | 0.3667 | 5.1 | 6bsg:B, 6bsh:B, 6bsj:B, 1hvu:B, 1hvu:E, 1hvu:H, 1hvu:K, 5j2p:B, 7so3:B, 8u6d:A, 8u6k:B |
6 | 3afg:B | 507 | 36 | 0.0826 | 0.0197 | 0.2778 | 5.6 | 3afg:A |
7 | 6hnd:B | 470 | 31 | 0.0909 | 0.0234 | 0.3548 | 7.8 | 6hnd:A, 6hnv:A, 6hnv:B |
8 | 3qde:A | 811 | 37 | 0.0826 | 0.0123 | 0.2703 | 7.9 | 8ho8:A, 8ho8:B, 3qde:B |
9 | 6oay:F | 558 | 26 | 0.0992 | 0.0215 | 0.4615 | 8.6 | 6og2:F |