HMTSPFKLPDESPSWTEWRLHNDETNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIG
CQYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAP
The query sequence (length=120) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6bjv:A | 148 | 124 | 0.9083 | 0.7365 | 0.8790 | 3.41e-79 | 6bjg:A, 6bjg:B, 6bjh:A, 6bjh:B, 6bjv:B, 4j39:A, 4j5v:A, 4jgn:A, 4jk0:D, 4jnx:A, 4jnx:D, 4knq:A, 4kq0:A, 4kq0:D, 4ktg:A, 1r9f:A, 1rpu:A, 1rpu:B |
2 | 3pps:A | 564 | 19 | 0.0750 | 0.0160 | 0.4737 | 4.7 | 3pps:B, 3pps:C, 3pps:D |
3 | 9bh5:CD | 289 | 22 | 0.0917 | 0.0381 | 0.5000 | 5.1 | 9cai:CD |
4 | 3afg:B | 507 | 36 | 0.0833 | 0.0197 | 0.2778 | 5.4 | 3afg:A |
5 | 1mpx:A | 614 | 41 | 0.1250 | 0.0244 | 0.3659 | 6.5 | 1mpx:B, 1mpx:C, 1mpx:D |
6 | 6oay:F | 558 | 26 | 0.1000 | 0.0215 | 0.4615 | 8.5 | 6og2:F |