BioLiP

>protein
HMTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHG
NDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISI
KAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFLPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASS
LLASLLKALGH

The query sequence (length=251) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1jcj:A	252	251	1.0000	0.9960	1.0000	0.0	5eky:A, 5el1:A, 5emu:A, 8for:A, 8for:B, 8for:C, 8for:D, 8for:E, 8for:F, 1jcj:B, 1jcl:A, 1jcl:B, 7p76:A, 7p76:B, 7p76:C, 7p76:D, 7p76:E, 7p76:F, 7p76:G, 7p76:H, 7p76:I, 7p76:J, 7p76:K, 7p76:L, 3q2d:A, 3q2d:B, 6z9i:B
2	3ngj:D	222	213	0.2789	0.3153	0.3286	2.25e-22	3ngj:A, 3ngj:B, 3ngj:C
3	1ub3:A	211	171	0.2351	0.2796	0.3450	5.23e-16	1ub3:B, 1ub3:C, 1ub3:D
4	3qyq:A	273	216	0.2470	0.2271	0.2870	1.10e-15	3qyq:B
5	5xhu:A	329	34	0.0518	0.0395	0.3824	1.9
6	8q9v:A	543	68	0.0916	0.0424	0.3382	2.4	8q9u:A
7	3al0:C	564	98	0.1036	0.0461	0.2653	2.7	3afh:A, 3akz:B, 3akz:D, 3akz:C, 3akz:A
8	6qud:A	837	28	0.0478	0.0143	0.4286	4.3
9	7nit:D	1253	31	0.0478	0.0096	0.3871	4.4	5dmy:A, 5dmy:B, 5dmy:C, 7nit:A, 7nit:B, 7nit:C, 7nit:E, 7nit:F, 6qub:A, 6qub:B, 6quc:A, 6quc:B
10	3i4l:A	524	50	0.0677	0.0324	0.3400	6.4	3i73:A
11	5lst:A	617	46	0.0598	0.0243	0.3261	8.9

[Back]