HMSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMDDPLDEFYSNTDVQLLVELD
YKGDMSIELSADLVLNYPSPQFMILPVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLLDKLQVDPSGPNFMGKRAL
ERISLIRNIKIHTELGGSVLRSVGKLEEFLVDLFRNLIRKEAAWPSWIDLD
The query sequence (length=211) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5h5a:A | 214 | 215 | 0.9905 | 0.9766 | 0.9721 | 3.63e-147 | 5h5a:B, 5h5a:C, 5h5a:D |
2 | 5yk6:A | 239 | 144 | 0.1469 | 0.1297 | 0.2153 | 2.96e-05 | 5yk7:C |
3 | 5aa0:BZ | 605 | 62 | 0.0900 | 0.0314 | 0.3065 | 0.76 | 5a9z:CA, 4zck:A, 4zcl:A, 4zcl:B, 4zcm:A, 4zcm:B |
4 | 5a9y:A | 562 | 62 | 0.0900 | 0.0338 | 0.3065 | 0.94 | 5a9x:A |
5 | 4ay8:A | 340 | 93 | 0.1517 | 0.0941 | 0.3441 | 2.1 | 4ay7:A, 4ay7:B, 4ay8:B |
6 | 2bue:A | 179 | 42 | 0.0664 | 0.0782 | 0.3333 | 3.2 | 2prb:A, 2qir:A, 1v0c:A, 2vqy:A |
7 | 8y7g:B | 543 | 112 | 0.1374 | 0.0534 | 0.2589 | 3.5 | 8y7g:A |
8 | 5o6c:A | 252 | 30 | 0.0474 | 0.0397 | 0.3333 | 5.7 | 6t7f:A |
9 | 7e24:D | 251 | 35 | 0.0711 | 0.0598 | 0.4286 | 6.2 | 7e24:A, 7e24:B, 7e24:C, 7e3x:A, 7e3x:B |
10 | 6yxy:Bi | 192 | 35 | 0.0616 | 0.0677 | 0.3714 | 9.4 | 7aoi:XS |