BioLiP

>protein
HMSQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADT
RTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLA

The query sequence (length=125) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3qzp:B	125	125	1.0000	1.0000	1.0000	8.90e-92	2itf:A, 2itf:B, 2itf:C, 2itf:D, 3qzl:A, 3qzm:A, 3qzm:B, 3qzn:A, 3qzn:B, 3qzn:C, 3qzo:A, 3qzo:C, 3qzo:B, 3qzo:D, 3qzp:A
2	3sik:A	123	109	0.2800	0.2846	0.3211	7.06e-11	3sik:B
3	4h8q:A	119	110	0.2560	0.2689	0.2909	1.05e-09	4h8p:A
4	4ymp:A	112	101	0.2000	0.2232	0.2475	0.003	4ymp:C
5	2k78:A	126	50	0.1520	0.1508	0.3800	0.005	2o6p:A, 2o6p:B
6	7pcf:F	341	93	0.1920	0.0704	0.2581	0.008	7pch:E, 7pch:F, 3rtl:A, 3rtl:B, 3rtl:C, 3rtl:D, 3rur:A, 3rur:B, 3rur:C, 3rur:D, 5vmm:F, 5vmm:E
7	7pcf:F	341	89	0.2000	0.0733	0.2809	0.063	7pch:E, 7pch:F, 3rtl:A, 3rtl:B, 3rtl:C, 3rtl:D, 3rur:A, 3rur:B, 3rur:C, 3rur:D, 5vmm:F, 5vmm:E
8	7w81:A	181	104	0.2000	0.1381	0.2404	0.19	3qug:A, 3qug:B, 3quh:A, 3quh:B, 3vtm:A, 3vtm:B, 7w81:B, 2z6f:A
9	8ap0:AAA	332	26	0.1040	0.0392	0.5000	0.63	8aoz:AAA, 6yqq:A
10	8rf0:A	2780	58	0.1040	0.0047	0.2241	1.5	8rfe:A, 8rfg:A
11	1g8s:A	230	108	0.2160	0.1174	0.2500	2.7
12	8c2z:A	334	52	0.1200	0.0449	0.2885	3.2
13	3wmt:A	503	51	0.1200	0.0298	0.2941	4.0	3wmt:B
14	8fqc:A	168	27	0.1040	0.0774	0.4815	6.6
15	7qh2:C	467	24	0.0880	0.0236	0.4583	7.8	7qh2:F
16	3rbh:D	410	33	0.0880	0.0268	0.3333	9.5	3rbh:C
17	8pz4:A	466	33	0.0880	0.0236	0.3333	9.7	7acg:A, 4afk:A, 4azl:A, 4azl:B, 4b61:A, 4b61:B, 8q2o:A, 3rbh:A, 3rbh:B, 8rqp:A, 4xnk:A, 4xnl:A
18	5d5d:A	403	33	0.0880	0.0273	0.3333	9.8

[Back]