HMPRFYLPENLSVGQTVDLPDNIVRHLNVLRVRPNENITLFDGKGKAHTARLTVLEKHRAEAEILHEDTTDNESPLNITL
IQSISSGDRMDFTLQKSVELGVTAIQPVISERCIVRAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSEN
TKLIMSINRACKLGDIRHPSGAIVFMVGPEGGWTEQEEQQAFEAGFQAVTLGKRILRTETAPLAAIAAMQTLWGDFT
The query sequence (length=237) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5vm8:B | 237 | 237 | 1.0000 | 1.0000 | 1.0000 | 4.34e-179 | |
2 | 5o96:D | 243 | 241 | 0.3671 | 0.3580 | 0.3610 | 3.83e-44 | 5o96:A, 5o96:B, 5o96:C, 5o96:E, 5o96:F, 5o96:G, 5o96:H |
3 | 2cx8:A | 225 | 213 | 0.2827 | 0.2978 | 0.3146 | 2.60e-25 | 2cx8:B, 2z0y:A, 2z0y:B |
4 | 3kw2:A | 240 | 237 | 0.2954 | 0.2917 | 0.2954 | 1.00e-22 | 3kw2:B |
5 | 2egv:A | 229 | 236 | 0.2996 | 0.3100 | 0.3008 | 2.17e-20 | 2egv:B, 2egw:A, 2egw:B |
6 | 4gxb:A | 263 | 133 | 0.1097 | 0.0989 | 0.1955 | 0.13 | 4tkn:A, 4tkn:B, 4tkn:C |
7 | 6sga:FC | 311 | 90 | 0.1055 | 0.0804 | 0.2778 | 0.55 | 6sgb:FC |
8 | 5azb:A | 284 | 27 | 0.0549 | 0.0458 | 0.4815 | 0.74 | 5azc:A |
9 | 6sga:FB | 377 | 90 | 0.1055 | 0.0663 | 0.2778 | 0.96 | 6sgb:FB |
10 | 1vc4:B | 254 | 56 | 0.0717 | 0.0669 | 0.3036 | 2.1 | |
11 | 3eue:A | 295 | 47 | 0.0633 | 0.0508 | 0.3191 | 2.6 | 3euf:A, 3euf:B, 3euf:C, 3euf:D, 3nbq:A, 3nbq:B, 3nbq:C, 3nbq:D |
12 | 6ixj:A | 251 | 38 | 0.0549 | 0.0518 | 0.3421 | 9.2 | 6ixj:B, 6ixj:C, 6ixj:D, 6ixj:E, 6ixj:F, 6ixj:G, 6ixj:H, 6ixj:I, 6ixj:J, 6ixj:K, 6ixj:L |
13 | 6ok4:A | 334 | 48 | 0.0464 | 0.0329 | 0.2292 | 9.2 | 6ok4:B, 6ok4:C, 6ok4:D, 6wyc:A, 6wyc:B, 6wyc:C, 6wyc:D, 6x2e:A, 6x2e:C, 6x2e:D |