HMPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHRYDEWIYWDSNRLRPLER
The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6l1p:C | 70 | 68 | 1.0000 | 0.9714 | 1.0000 | 1.35e-46 | 6l1f:B, 6l1p:B, 6l1p:A, 6l1p:D |
2 | 2rhu:A | 325 | 60 | 0.2647 | 0.0554 | 0.3000 | 1.30e-05 | 6byb:A, 3oq5:A, 3oq5:C, 3p8h:A, 3p8h:B, 2pqw:A, 2rhi:A, 2rhx:A, 2rhy:A, 2rje:A, 2rje:B, 2rjf:A, 2rjf:C, 3uwn:A |
3 | 2rhu:A | 325 | 60 | 0.2941 | 0.0615 | 0.3333 | 1.55e-04 | 6byb:A, 3oq5:A, 3oq5:C, 3p8h:A, 3p8h:B, 2pqw:A, 2rhi:A, 2rhx:A, 2rhy:A, 2rje:A, 2rje:B, 2rjf:A, 2rjf:C, 3uwn:A |
4 | 2vyt:B | 183 | 63 | 0.2647 | 0.0984 | 0.2857 | 1.55e-04 | |
5 | 2vyt:A | 214 | 63 | 0.2647 | 0.0841 | 0.2857 | 0.001 | 4edu:A |
6 | 3ut1:A | 313 | 56 | 0.2500 | 0.0543 | 0.3036 | 0.001 | 4fl6:A, 4fl6:B, 4l59:A |
7 | 3ut1:A | 313 | 61 | 0.2500 | 0.0543 | 0.2787 | 0.019 | 4fl6:A, 4fl6:B, 4l59:A |
8 | 3ut1:A | 313 | 64 | 0.2353 | 0.0511 | 0.2500 | 6.9 | 4fl6:A, 4fl6:B, 4l59:A |
9 | 4c5i:A | 423 | 60 | 0.2353 | 0.0378 | 0.2667 | 0.005 | |
10 | 3f70:A | 392 | 62 | 0.2206 | 0.0383 | 0.2419 | 0.007 | |
11 | 6bhd:A | 217 | 63 | 0.3088 | 0.0968 | 0.3333 | 0.009 | 6au2:A, 6au3:A, 6bhe:A, 6bhg:A, 6bhh:A, 6bhi:A, 6bpi:A, 7c9n:B, 7c9n:A, 7caj:D, 7caj:A, 7cd9:A, 7cd9:B, 7cjt:D, 7cjt:A, 7cjt:B, 7cjt:C, 8g5e:A, 5kch:A, 5kco:A, 5ke2:A, 5ke3:A, 5kh6:A, 5qt1:A, 5qt2:A, 8uwp:A, 8uwp:B |
12 | 3h6z:A | 431 | 61 | 0.2647 | 0.0418 | 0.2951 | 0.025 | 4c5h:A, 3h6z:B |
13 | 3f70:B | 410 | 60 | 0.2206 | 0.0366 | 0.2500 | 0.036 | |
14 | 4pl6:A | 57 | 52 | 0.2353 | 0.2807 | 0.3077 | 0.43 | 4pl6:B, 4pli:A, 4pli:B, 4pll:A, 4pll:B |
15 | 8bja:B | 1638 | 34 | 0.1765 | 0.0073 | 0.3529 | 3.8 | |
16 | 8ewi:A | 1775 | 34 | 0.1765 | 0.0068 | 0.3529 | 3.8 | 8ewi:B, 8ewi:C, 8ewi:D |
17 | 8p82:A | 1596 | 34 | 0.1765 | 0.0075 | 0.3529 | 4.1 | 8p82:B |
18 | 8d4x:B | 1669 | 34 | 0.1765 | 0.0072 | 0.3529 | 4.2 | 8c06:A, 8c06:D |
19 | 8e0q:A | 1689 | 34 | 0.1765 | 0.0071 | 0.3529 | 4.2 | 8d4x:A, 8e0q:B |
20 | 7xva:A | 226 | 31 | 0.1765 | 0.0531 | 0.3871 | 4.5 | |
21 | 2r58:A | 212 | 58 | 0.2500 | 0.0802 | 0.2931 | 6.1 | 2r5a:A, 2r5m:A |
22 | 8c07:B | 450 | 34 | 0.1765 | 0.0267 | 0.3529 | 6.1 | |
23 | 2j72:B | 103 | 23 | 0.1176 | 0.0777 | 0.3478 | 6.4 | 2j72:A, 2j73:A, 2j73:B |
24 | 6d41:B | 579 | 28 | 0.1618 | 0.0190 | 0.3929 | 6.7 | 6d41:A, 6d6w:A, 6d6w:B, 6d6w:C, 6d6w:D, 6d7f:A, 6d7f:B, 6d7f:C, 6d7f:D, 6d7f:E, 6d7f:F |