BioLiP

>protein
HMKYGIVGYSGRMGQEIQKVFSEKGHELVLKVDVNGVEELDSPDVVIDFSSPEALPKTVDLCKKYRAGLVLGTTALKEEH
LQMLRELSKEVPVVQAYNFSIGINVLKRFLSELVKVLEDWDVEIVETHHRFKKDAPSGTAILLESALGKSVPIHSLRVGG
VPGDHVVVFGNIGETIEIKHRAISRTVFAIGALKAAEFLVGKDPGMYSFEEVIFG

The query sequence (length=215) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1vm6:B	218	214	0.9953	0.9817	1.0000	1.09e-155	1vm6:A, 1vm6:C, 1vm6:D
2	4ywj:A	268	263	0.4000	0.3209	0.3270	3.52e-42	4ywj:B
3	5tej:A	269	263	0.3814	0.3048	0.3118	4.76e-41	5tej:B, 5tej:C, 5tej:D, 5tem:C, 5tem:A, 5ten:A, 5ten:B, 5ten:C, 5ten:D, 5ten:E, 5ten:F, 5ten:G, 5ten:H, 5us6:A, 5us6:B, 5us6:C, 5us6:E, 5us6:F, 5us6:G, 5us6:I, 5us6:J, 5us6:K
4	1dih:A	272	264	0.3907	0.3088	0.3182	3.21e-38	1arz:A, 1arz:B, 1arz:C, 1arz:D, 1dru:A, 1drv:A, 1drw:A
5	3ijp:B	267	263	0.3535	0.2846	0.2890	6.56e-28	3ijp:A
6	5wol:A	230	227	0.3163	0.2957	0.2996	2.47e-24
7	5eer:A	247	226	0.3256	0.2834	0.3097	7.74e-23	5ees:A
8	5z2e:A	265	244	0.3302	0.2679	0.2910	2.37e-19	5z2f:A
9	1yl5:A	247	237	0.2930	0.2551	0.2658	2.38e-17	1c3v:A, 1c3v:B, 1p9l:A, 1p9l:B, 5tjy:A, 5tjz:A, 5ugv:A, 5ugv:B, 1yl5:B, 1yl6:A, 1yl6:B, 1yl7:A, 1yl7:B, 1yl7:C, 1yl7:D, 1yl7:E, 1yl7:F, 1yl7:G, 1yl7:H
10	5u5n:A	279	186	0.1860	0.1434	0.2151	0.004	5u5i:A, 5u5i:B, 5u5n:B
11	1vl0:A	281	68	0.1023	0.0783	0.3235	0.34	1vl0:B, 1vl0:C
12	6c48:D	87	58	0.0698	0.1724	0.2586	0.47	6c48:A
13	3p19:A	239	60	0.0977	0.0879	0.3500	0.58	3p19:B, 3p19:C, 3p19:D
14	1lss:A	132	32	0.0651	0.1061	0.4375	0.72	1lss:B, 1lss:C, 1lss:D
15	7opk:A	649	79	0.1023	0.0339	0.2785	2.6
16	2j6c:A	109	33	0.0558	0.1101	0.3636	3.3
17	4rlf:B	519	50	0.0791	0.0328	0.3400	3.5	6m2t:A, 6m2t:B, 6m2t:C, 6m2t:D, 6m2u:A, 6m2u:B, 4rlf:A, 4rlq:A, 4rlq:B, 4rm2:A, 4rm2:B, 4rm3:A, 4rm3:B, 4rmn:A, 4rmn:B, 4zjz:A, 4zjz:B
18	5wvp:A	924	122	0.1442	0.0335	0.2541	4.6
19	5mdn:A	761	103	0.1116	0.0315	0.2330	5.3	5mdn:B
20	2ggs:A	273	81	0.1070	0.0842	0.2840	5.5	2ggs:B
21	8jus:A	335	23	0.0558	0.0358	0.5217	5.8	8jus:B
22	8vxb:A	284	39	0.0744	0.0563	0.4103	6.6
23	6uzi:C	470	33	0.0558	0.0255	0.3636	6.7	6uzi:A, 6uzi:B, 6uzi:D
24	7tom:A	498	42	0.0651	0.0281	0.3333	7.0	7tol:A
25	6uiw:A	294	89	0.1116	0.0816	0.2697	7.4	6uiw:B, 6uiw:C, 6uiw:D, 6uiw:E, 6uiw:F, 6uiw:G, 6uiw:H, 6uiw:I, 6uiw:J, 6uiw:K
26	8ctr:A	298	59	0.0791	0.0570	0.2881	9.7	8ctr:B, 8ctr:C, 8ctr:D
27	5hvq:C	236	27	0.0605	0.0551	0.4815	9.8	5wy5:A

[Back]