HMKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLL
TIYGKNEMSDLNANQRKQLMAFMEAWRNEQ
The query sequence (length=110) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8a0x:D | 110 | 110 | 1.0000 | 1.0000 | 1.0000 | 1.41e-78 | 5ja8:C |
2 | 4v7j:Ay | 94 | 72 | 0.1545 | 0.1809 | 0.2361 | 1.5 | 4v7j:By, 4v7k:Ay, 4v7k:By |
3 | 6pvk:U | 90 | 54 | 0.1545 | 0.1889 | 0.3148 | 1.6 | |
4 | 4bju:A | 548 | 16 | 0.1000 | 0.0201 | 0.6875 | 5.4 | 4bju:B, 5o9x:A, 5oaw:A, 5oaw:B |
5 | 2zwa:B | 683 | 36 | 0.1182 | 0.0190 | 0.3611 | 5.6 | 2zw9:A, 2zw9:B, 2zwa:A |
6 | 6hiv:Ab | 453 | 38 | 0.1364 | 0.0331 | 0.3947 | 6.2 | 6hix:Ab |