BioLiP

>protein
HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRK
KLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR

The query sequence (length=132) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3gn5:A	132	132	1.0000	1.0000	1.0000	1.74e-97	3ga8:A, 3gn5:B, 3hi2:A, 3hi2:C, 3o9x:A, 3o9x:B
2	8a0x:A	103	62	0.1061	0.1359	0.2258	1.83e-04	8a0w:A, 8a0w:B, 8a0x:B
3	7tmb:A	362	69	0.1364	0.0497	0.2609	0.59	7tmb:B, 7tmb:C, 7tmb:D, 7tmb:E, 7tmb:F
4	1gvr:A	364	90	0.1667	0.0604	0.2444	0.87	2aba:A, 2abb:A, 3f03:K, 6gi7:A, 6gi8:A, 6gi9:A, 6gia:A, 1gvo:A, 1gvq:A, 1gvs:A, 1h50:A, 1h51:A, 1h60:A, 1h61:A, 1h62:A, 1h63:A, 3kft:A, 3kft:B, 5lgx:A, 5lgz:A, 3p62:A, 3p67:A, 3p74:A, 3p7y:A, 3p80:A, 3p81:A, 3p82:A, 3p84:A, 3p8i:A, 3p8j:A, 1vyp:X, 1vyr:A, 1vys:X
5	4ccz:A	611	34	0.0682	0.0147	0.2647	1.2
6	8tac:B	66	38	0.1061	0.2121	0.3684	2.2
7	1o72:A	175	55	0.1061	0.0800	0.2545	2.5	1o72:B
8	6qkb:A	384	28	0.0985	0.0339	0.4643	3.7	6qkb:B
9	2yjg:A	418	26	0.0909	0.0287	0.4615	4.8	2yjg:B
10	4kx4:A	217	17	0.0606	0.0369	0.4706	5.4	7d9l:A, 7dkp:A, 7dkp:B, 7dkp:C, 7dkp:D
11	3ir4:A	218	17	0.0606	0.0367	0.4706	7.1
12	5aa5:A	345	39	0.1136	0.0435	0.3846	7.7	5aa5:B, 5aa5:D, 5aa5:F, 5aa5:H, 5aa5:M
13	4u39:D	280	40	0.0985	0.0464	0.3250	7.7	4u39:H, 4u39:I
14	7pd1:B	367	35	0.0985	0.0354	0.3714	8.6	7pd1:A, 7pd2:A, 7pd2:B
15	2rhl:B	315	40	0.0985	0.0413	0.3250	9.6	2rhl:A, 2rho:A, 2rho:B, 4u39:B, 4u39:E, 4u39:F, 4u39:G
16	5x11:E	181	26	0.0909	0.0663	0.4615	9.6	5x11:A, 5x11:B, 5x11:D, 5x11:C, 5x11:F, 5x11:H, 5x14:A

[Back]