HMAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCP
EGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTV
VCAVQAGEGETALE
The query sequence (length=174) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2iph:A | 180 | 180 | 0.9138 | 0.8833 | 0.8833 | 1.54e-115 | 6bib:A, 6bib:B, 6bic:A, 6bic:B, 6bid:A, 5dg6:A, 5dgj:A, 5e0g:A, 5e0h:A, 5e0j:A, 4imq:A, 4imz:A, 4inh:B, 4inh:A, 4inh:C, 4inh:D, 4inh:E, 4inh:F, 4inh:G, 4inh:H, 2iph:B, 6t2i:A, 6t3g:A, 6t49:A, 6t4e:A, 6t4e:B, 6t5d:B, 6t5r:B, 5t6d:A, 5t6d:B, 5t6f:A, 5t6f:B, 5t6g:A, 5t6g:B, 6t6w:A, 6t71:B, 6t82:B, 6t8r:A, 6t8r:B, 6t8t:B, 6tal:B, 6taw:A, 6taw:B, 6tbo:A, 6tbo:B, 6tbp:A, 6tcf:B, 5tg1:A, 5tg2:A, 6tgl:B, 3ur9:A, 3ur9:B, 6w5h:A, 6w5h:B, 6w5h:C, 6w5h:D, 6w5j:A, 6w5j:B, 6w5k:A, 6w5k:B, 6w5k:C, 6w5k:D, 6w5l:A, 6w5l:B, 6w5l:C, 6w5l:D, 5wej:A, 5wej:B, 4xbb:A, 4xbc:A, 4xbd:A, 4xbd:B |
2 | 6nir:B | 170 | 169 | 0.6034 | 0.6176 | 0.6213 | 6.18e-78 | 8u1w:A |
3 | 4x2v:A | 174 | 172 | 0.5402 | 0.5402 | 0.5465 | 7.86e-64 | 4x2v:D |
4 | 8xku:A | 730 | 47 | 0.0977 | 0.0233 | 0.3617 | 1.2 | 8xkv:A |
5 | 2vbc:A | 600 | 55 | 0.1034 | 0.0300 | 0.3273 | 1.2 | 2jlr:A, 2jls:A, 2jlu:A, 2jlu:B, 2jlv:A, 2jlv:B, 2jlw:A, 2jlw:B, 2jlx:A, 2jlx:B, 2jly:A, 2jly:B, 2jlz:A, 2jlz:B, 2whx:A, 2wzq:A, 5xc6:A, 5xc6:B, 5yvj:B |
6 | 2rau:A | 350 | 81 | 0.1149 | 0.0571 | 0.2469 | 2.4 | |
7 | 3i0o:A | 329 | 49 | 0.0977 | 0.0517 | 0.3469 | 3.4 | 3i0q:A, 3q2m:A |
8 | 3ty7:B | 454 | 42 | 0.0690 | 0.0264 | 0.2857 | 3.8 | |
9 | 4yet:B | 200 | 51 | 0.0920 | 0.0800 | 0.3137 | 3.8 | 4yet:A |
10 | 3qyy:B | 156 | 94 | 0.1494 | 0.1667 | 0.2766 | 5.1 | 3qyy:A |
11 | 8ulg:B | 824 | 26 | 0.0575 | 0.0121 | 0.3846 | 5.4 | 7jsn:B, 6mzb:B, 8ufi:B, 8ugb:B, 8ugs:B |
12 | 2o20:B | 275 | 61 | 0.0977 | 0.0618 | 0.2787 | 6.1 | 2o20:A, 2o20:F, 2o20:G |
13 | 3u4j:A | 505 | 44 | 0.0805 | 0.0277 | 0.3182 | 6.6 | |
14 | 4caz:A | 489 | 44 | 0.0920 | 0.0327 | 0.3636 | 9.5 | 4caz:B, 2wme:A, 2wme:B, 2wme:C, 2wme:D, 2wme:E, 2wme:F, 2wme:G, 2wme:H, 2wox:A, 2wox:B, 2wox:C, 2wox:D, 2xdr:A, 2xdr:B, 2xdr:C, 2xdr:D, 3zqa:A, 3zqa:B, 3zqa:C, 3zqa:D |