Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
HMAIEFDIQESKILKGVYIITPNKFRDLRGEIWTAFTSEAVDKLLPNGLKFIHDKFIHSKHNVIRGIHGDVKTYKLATCV
YGEVHQVVVDCRKDSPTYLKHERFIINQDNQKIILVPAGFGNAHYVSSETAVYYYKCAYLGEYMDAPDQFTYAWNDERIG
IDWPTNNPILSERDILAM

The query sequence (length=178) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 8dcl:A 185 175 0.9157 0.8811 0.9314 1.57e-124 7anj:A, 7anj:B, 8dak:A, 8dak:B, 8dcl:B
2 7m15:D 181 176 0.8146 0.8011 0.8239 1.46e-108 7an4:A, 7an4:B, 7an4:D, 7m14:A, 7m14:B, 7m14:C, 7m14:D, 7m14:E, 7m14:F, 7m15:A, 7m15:B, 7m15:C, 7m15:E, 7m15:F
3 8dco:B 181 177 0.7753 0.7624 0.7797 3.26e-104 8db5:A, 8db5:B, 8db5:C, 8db5:D, 8db5:E, 8db5:F, 8db5:G, 8db5:H, 8dco:A
4 1dzt:A 183 165 0.3146 0.3060 0.3394 4.62e-27 1dzt:B
5 6c46:A 183 166 0.3146 0.3060 0.3373 1.38e-23 6c46:D
6 6ndr:A 188 162 0.2921 0.2766 0.3210 1.50e-22 6ndr:B
7 2ixh:A 184 161 0.2753 0.2663 0.3043 2.23e-21 2ixh:B, 2ixi:B, 2ixi:A, 2ixk:A, 2ixk:B
8 3ryk:A 175 177 0.3034 0.3086 0.3051 1.09e-19 3ryk:B
9 1epz:A 183 170 0.3146 0.3060 0.3294 6.02e-18
10 7pvi:AAA 199 178 0.3146 0.2814 0.3146 6.36e-18 7pvi:BBB, 7pwb:AAA, 7pwb:BBB
11 5buv:A 174 169 0.2865 0.2931 0.3018 5.71e-14 5buv:B
12 2ixc:A 198 170 0.2584 0.2323 0.2706 2.08e-12 2ixc:B, 2ixc:C, 2ixc:D
13 1oi6:A 202 178 0.2809 0.2475 0.2809 2.72e-11 1oi6:B
14 7pwh:AAA 203 165 0.2584 0.2266 0.2788 2.17e-10
15 4hn1:C 201 165 0.2360 0.2090 0.2545 3.81e-07 4hmz:A, 4hmz:B, 4hmz:C, 4hmz:D, 4hn1:A, 4hn1:B, 4hn1:D
16 2ixl:C 197 116 0.1966 0.1777 0.3017 0.008 2ixl:A, 2ixl:B, 2ixl:D, 1nyw:A, 1nyw:B, 1nzc:A, 1nzc:B, 1nzc:C, 1nzc:D
17 7s6e:B 400 87 0.1348 0.0600 0.2759 1.5 7s6e:A
18 8hic:A 395 90 0.1404 0.0633 0.2778 1.8 7s6f:A
19 6rxt:CN 226 25 0.0562 0.0442 0.4000 3.3 5oql:e, 6rxu:CN, 6rxv:CN, 6rxx:CN, 6rxy:CN, 6rxz:CN
20 4nap:D 310 42 0.0899 0.0516 0.3810 8.3 4nap:A, 4nap:B, 4nap:C, 4pgn:A, 4pgn:B, 4pgn:C, 4pgn:D, 4pgp:A, 4pgp:B, 4pgp:C, 4pgp:D

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218