HLTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETEAYLGPEDEAAHSRGGRQTPRNRGMFMKPGTLYVYII
YGMYFCMNISSQGDGACVLLRALEPLEGLETMRQLRSTVLKDRELCSGPSKLCQALAINKSFDQRDLAQDEAVWLERGPA
VVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQD
The query sequence (length=200) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1f6o:A | 211 | 209 | 1.0000 | 0.9479 | 0.9569 | 1.25e-143 | 1bnk:A, 1ewn:A, 1f4r:A, 3qi5:A, 3qi5:B, 3uby:A, 7xfh:K, 7xfj:K, 7xfm:K |
2 | 2bko:A | 190 | 50 | 0.0650 | 0.0684 | 0.2600 | 0.73 | |
3 | 1hcy:A | 644 | 59 | 0.0900 | 0.0280 | 0.3051 | 5.6 | |
4 | 6l8s:A | 650 | 59 | 0.0900 | 0.0277 | 0.3051 | 5.7 | 1hc1:A, 1hc1:B, 1hc1:C, 1hc1:D, 1hc1:E, 1hc1:F, 6l8s:B, 6l8s:C |
5 | 2bo2:A | 140 | 49 | 0.0550 | 0.0786 | 0.2245 | 9.0 | 2bo2:B, 2bou:A, 7do4:A |