HLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQ
The query sequence (length=210) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
4o56:A |
244 |
220 |
1.0000 |
0.8607 |
0.9545 |
1.68e-155 |
6ax4:A, 3bzi:A, 3c5l:A, 8crc:A, 4dfw:A, 5dms:A, 5dms:C, 5dmv:C, 5dnj:A, 4e67:A, 4e9c:A, 4e9d:A, 3fvh:A, 6gy2:B, 6gy2:A, 4h71:A, 4hab:A, 4hab:B, 4hab:C, 4hco:A, 3hik:A, 4hy2:A, 5j19:B, 5j19:A, 8joq:A, 8joy:A, 4lkl:A, 4lkm:A, 4lkm:C, 7mso:A, 7mso:B, 7mx1:A, 7mx1:B, 5nei:A, 5nfu:A, 5nje:A, 5nmm:A, 5nn2:A, 4o6w:A, 4o9w:A, 2ojx:A, 3p2z:A, 3p34:A, 3p35:A, 3p35:B, 3p36:A, 3p37:A, 3p37:B, 3p37:C, 3q1i:A, 1q4k:A, 1q4k:B, 1q4k:C, 4rcp:A, 3rq7:A, 8s30:A, 8s31:A, 8s31:B, 1umw:A, 1umw:B, 8wfp:A, 8wfp:B, 4whh:A, 4whk:A, 4whl:A, 5x3s:B, 5x3s:A, 4x9r:A, 4x9v:A, 4x9w:A |
2 |
6mf5:B |
262 |
160 |
0.2429 |
0.1947 |
0.3187 |
4.53e-21 |
6mf4:A, 6mf5:A, 6mf6:B, 6mf6:A |
3 |
8tpm:B |
615 |
128 |
0.1476 |
0.0504 |
0.2422 |
0.10 |
8tpm:A, 8tpo:B, 8tpo:A, 8tpp:A, 8tpp:B, 8tpr:A, 8tpr:B |
4 |
6qm5:A |
673 |
72 |
0.0905 |
0.0282 |
0.2639 |
0.31 |
6qm5:B, 6qm9:A, 6qm9:B, 6qma:A, 6qma:B, 6qmb:A, 6qmb:B, 8toi:A, 8toi:B, 8tok:A, 8tok:B, 8tol:A, 8tol:B, 4wis:A, 4wis:B, 4wit:A, 4wit:B |
5 |
6ogz:A |
1082 |
75 |
0.1048 |
0.0203 |
0.2933 |
0.52 |
6ogy:A, 6oj6:P, 2r7r:A, 2r7s:A, 2r7t:A, 2r7u:A, 2r7v:A, 2r7w:A, 2r7x:A, 2r7x:B |
6 |
8hz4:A |
456 |
97 |
0.1143 |
0.0526 |
0.2474 |
0.84 |
8hz4:B, 8hz4:C, 8hz4:D |