HLQLPRPVCEAIIRPVPEHRADQELSEIYRDLKATFGVPWVGVITQAVAYYRPFFAEAWRRFAPSAKTHFFERASDDIRI
RSWELMGQSFVIEGQTDRLREMGYSVREIGQIRAVLDIFDYGNPKYLIFATAIKEGLLSGRTFGGAAGDARCHFPRSPIC
QIDPIPVMVEEHHAGGTLSQVYADIKQTLQLPFINSNYKAMARWPSYLEQAWGALKPCIDTPAYQAGRFDINARALAALD
ALPTAYRMSRDDALQAGLSEAQTDELIQVISLFQWMLSGLVLNVTHFKQQAL
The query sequence (length=292) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5gzx:A | 292 | 292 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 5gzx:B, 5gzx:C, 5gzx:D |
2 | 3wj8:A | 298 | 203 | 0.2123 | 0.2081 | 0.3054 | 1.35e-20 | 3wj8:B, 3wj8:D, 3wj8:E, 3wj8:F, 3wj8:G |
3 | 3wj8:A | 298 | 121 | 0.1096 | 0.1074 | 0.2645 | 4.18e-10 | 3wj8:B, 3wj8:D, 3wj8:E, 3wj8:F, 3wj8:G |
4 | 3i5f:A | 810 | 90 | 0.0788 | 0.0284 | 0.2556 | 1.2 | |
5 | 1iqp:A | 326 | 24 | 0.0411 | 0.0368 | 0.5000 | 8.3 | 1iqp:B, 1iqp:C, 1iqp:E |