HLPKVAQSFLNLLCAQTSLTFSIVVLDEHEVVPVARSYLPQQDNRVSPYGMHLGNRLPAHATSTGKVLLSVLDREVQIEW
IEKYGLKRLTPYTITDEHTFLETLDAVRQSDYCLSTEEHELGVIAIAVPVLNAQGLTIAALNCMSQTNRVQPQYLIDQVL
PLLRNTANELRNLV
The query sequence (length=174) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5hpf:A | 175 | 174 | 1.0000 | 0.9943 | 1.0000 | 1.73e-128 | 5hpf:C, 5hpi:A, 5hpi:B, 5hpi:C, 5hpi:D |
2 | 8eju:B | 257 | 165 | 0.2931 | 0.1984 | 0.3091 | 1.10e-20 | 8eju:A |
3 | 1mkm:A | 246 | 167 | 0.2356 | 0.1667 | 0.2455 | 1.96e-11 | |
4 | 2o99:C | 182 | 148 | 0.2069 | 0.1978 | 0.2432 | 5.63e-08 | 2o99:A, 2o99:B, 2o99:D, 2o9a:A, 2o9a:B, 2o9a:C, 2o9a:D |
5 | 2xro:B | 240 | 76 | 0.1609 | 0.1167 | 0.3684 | 0.028 | 2xro:A, 2xro:E, 2xro:F |
6 | 5whm:A | 263 | 113 | 0.1494 | 0.0989 | 0.2301 | 0.34 | |
7 | 3ppo:A | 272 | 78 | 0.1149 | 0.0735 | 0.2564 | 2.0 | 3ppo:B, 3ppq:A, 3ppq:B, 3ppr:A, 3ppr:B |
8 | 8qnc:A | 486 | 79 | 0.1264 | 0.0453 | 0.2785 | 5.9 | 8qmy:A, 8qmy:B, 8qmy:C, 8qnb:A, 8qnr:A |