HLKSTCRVCAKYASNKRSPKLFERSNTKMIDNIEALTGLRLENYGCLPDQICECCSMELASAVKLRERCIAAQRELLLGL
TEEQRQGI
The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7po9:A | 88 | 88 | 1.0000 | 1.0000 | 1.0000 | 1.02e-60 | 7po9:B |
2 | 3guw:A | 233 | 32 | 0.1364 | 0.0515 | 0.3750 | 0.20 | 3guw:B, 3guw:C, 3guw:D |
3 | 4izt:A | 263 | 68 | 0.2386 | 0.0798 | 0.3088 | 0.22 | 4izs:A, 4izu:A, 4izv:A, 4izw:A, 5ny7:A, 5nyb:A, 5nyc:A, 5nye:A |
4 | 6nr7:A | 1086 | 36 | 0.1364 | 0.0110 | 0.3333 | 0.42 | 4dj9:A, 4e17:A, 6fq4:A, 2gdc:A, 2gww:A, 2hsq:A, 2ibf:A, 5l0c:B, 5l0c:C, 5l0c:D, 5l0d:B, 5l0d:D, 5l0g:B, 5l0g:C, 5l0h:A, 4pr9:D, 4pr9:E, 4pr9:F, 3rf3:A, 3rf3:B, 1rkc:A, 3s90:A, 3s90:B, 1syq:A, 1t01:A, 3tj5:A, 3tj6:A, 1u6h:A, 1xwj:A, 1ydi:A, 3zdl:A, 1zvz:A, 1zw2:A, 1zw3:A |
5 | 7w6l:C | 158 | 54 | 0.1818 | 0.1013 | 0.2963 | 1.5 | 5f59:A, 5f6k:C, 5f6k:E, 6kiw:K, 7w6l:E |
6 | 7vcf:A | 1496 | 29 | 0.1364 | 0.0080 | 0.4138 | 1.7 | |
7 | 7xzi:A | 1598 | 29 | 0.1364 | 0.0075 | 0.4138 | 1.7 | |
8 | 5dis:C | 264 | 23 | 0.0909 | 0.0303 | 0.3478 | 6.4 | 1xk5:A |
9 | 7xzj:A | 423 | 29 | 0.1364 | 0.0284 | 0.4138 | 8.0 | |
10 | 4v8z:CV | 568 | 39 | 0.1591 | 0.0246 | 0.3590 | 8.9 | |
11 | 1g7s:A | 576 | 39 | 0.1591 | 0.0243 | 0.3590 | 8.9 | 1g7t:A |