BioLiP

>protein
HLGPQFCKSCWAENKGLVECNNHYLCLNCLTLLLGVSSRCPICKMPLPT

The query sequence (length=49) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2m1s:A	99	49	0.9388	0.4646	0.9388	9.13e-22	7ckl:B, 7ela:B, 5i72:A, 5i72:B
2	7x6v:B	48	48	0.6327	0.6458	0.6458	3.14e-17
3	7ckm:B	49	47	0.4694	0.4694	0.4894	1.73e-09	7el9:B, 7el9:E, 7elb:B, 7elb:D, 7elc:B, 7vgq:B, 7vh1:B
4	2ff0:A	102	47	0.3061	0.1471	0.3191	0.27	2a66:A, 5l0m:A, 8pki:K
5	6f98:A	78	25	0.2245	0.1410	0.4400	0.54
6	6wi7:A	206	45	0.2857	0.0680	0.3111	2.2	2ckl:A, 8grm:M, 2h0d:A, 7nd1:H, 8pp7:K, 8pp7:M, 4r8p:K, 4r8p:M, 3rpg:B, 6wi8:A, 6wi8:B
7	4xgc:C	567	33	0.2653	0.0229	0.3939	2.5
8	7r70:A	150	21	0.1633	0.0533	0.3810	2.7	5d0i:A, 5d0i:B, 5d0k:C, 5d0k:F, 5d0k:I, 5d0k:L, 7r70:B, 7r71:A
9	1chc:A	68	25	0.1837	0.1324	0.3600	2.8
10	7oik:A	4426	50	0.3469	0.0038	0.3400	3.1	7oim:A, 6tax:A, 6tay:A
11	1bor:A	56	44	0.3673	0.3214	0.4091	3.3	2mwx:A, 5yuf:A, 5yuf:B, 5yuf:C, 5yuf:D
12	7jgs:C	614	33	0.2653	0.0212	0.3939	3.7	7jgr:C, 7jk2:C, 7jk3:C, 7jk4:C, 7jk5:C, 7jk6:C
13	6y2n:A	306	18	0.1837	0.0294	0.5000	4.8
14	2csy:A	81	34	0.2245	0.1358	0.3235	6.3
15	6l8n:A	810	37	0.2449	0.0148	0.3243	7.0
16	1iym:A	55	26	0.1633	0.1455	0.3077	9.1
17	4ond:A	72	47	0.3061	0.2083	0.3191	9.5	4ond:B, 4ond:E, 4ond:F

[Back]