HHVKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGKNADIKRILDKEGEQMLAAAGKNRIVTLDIPGKP
WDTPQLAAELERWKLDGRDVSLLIGGPEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE
The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5twj:C | 157 | 157 | 1.0000 | 1.0000 | 1.0000 | 1.90e-115 | 5twj:D, 5twj:A, 5twj:B, 5twk:C, 5twk:D, 5twk:A, 5twk:B |
2 | 4fak:A | 163 | 159 | 0.3057 | 0.2945 | 0.3019 | 4.73e-21 | |
3 | 8xud:D | 651 | 135 | 0.2357 | 0.0568 | 0.2741 | 0.37 | 6iqq:C, 6iqq:D, 5wql:D, 5wql:C, 8xud:C |
4 | 1axn:A | 323 | 66 | 0.1146 | 0.0557 | 0.2727 | 1.3 | 1aii:A |
5 | 7du5:B | 118 | 39 | 0.1083 | 0.1441 | 0.4359 | 1.6 | 7du5:A, 5hjz:A, 5hjz:B |
6 | 8w5s:A | 301 | 91 | 0.1592 | 0.0831 | 0.2747 | 1.9 | 8w5s:B, 8w5s:C |
7 | 1vl8:B | 252 | 54 | 0.0892 | 0.0556 | 0.2593 | 4.0 | 1vl8:A |
8 | 1pca:A | 402 | 24 | 0.0637 | 0.0249 | 0.4167 | 4.6 | |
9 | 2h7y:A | 280 | 76 | 0.1465 | 0.0821 | 0.3026 | 4.7 | 9cgl:A, 9cgl:B, 9cgn:A, 9cgn:B, 2h7x:A, 2h7x:B, 2h7y:B, 2hfj:A, 2hfk:A, 2hfk:B |
10 | 4apm:A | 339 | 77 | 0.1338 | 0.0619 | 0.2727 | 6.3 |