HHNKVRTCWNEGRPALAGWLQLPGTLHAEALARLDYDAVVIDMQHSPIDFGQVAPMLIAIELGGAEPFVRTQVNDPSDIM
KLLDAGAYGIIAPMVNTRAEAQTLASALHYSPRGLRSFGPRRPSLRYGSGYLAQASETVVGLAMIETREALANIDEILSV
DGIDGVFIGPTDLALDLGHAPLVDTEEAEVVSAIAHVRERAHAAGKRVGIFCGSGGFARVKLAEGFDFVTAAPDLAMLSA
AARQVIADARAL
The query sequence (length=252) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8adq:A | 252 | 252 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7nnk:A, 7nnk:B, 7nr1:A, 7nuj:A, 7nuj:B, 7o5r:A, 7o5r:B, 7o5v:AAA, 7o5v:BBB, 7o5w:AAA, 7o5w:BBB, 7o87:AAA, 7o87:BBB, 7o9r:AAA, 7o9r:BBB, 7obu:A, 7obu:B, 6r62:A |
2 | 1dxe:A | 253 | 245 | 0.3095 | 0.3083 | 0.3184 | 5.11e-40 | 1dxe:B, 1dxf:A, 1dxf:B |
3 | 2v5k:A | 260 | 238 | 0.3413 | 0.3308 | 0.3613 | 1.87e-38 | 4b5s:A, 4b5s:B, 4b5t:A, 4b5t:B, 4b5u:A, 4b5u:B, 4b5v:A, 4b5v:B, 4b5w:A, 4b5w:B, 4b5w:C, 4b5w:D, 4b5w:E, 4b5w:F, 2v5k:B |
4 | 7et9:A | 254 | 237 | 0.3095 | 0.3071 | 0.3291 | 1.64e-33 | 7et9:B, 7et9:C, 7eta:A, 7eta:B, 7eta:C, 7etb:A, 7etb:B, 7etb:C, 7etc:A, 7etc:C, 7etc:B, 7etd:A, 7etd:B, 7etd:C, 7ete:A, 7ete:C, 7ete:B, 7etf:A, 7etf:B, 7etf:C, 7etg:A, 7etg:B, 7etg:C, 7eth:A, 7eth:B, 7eth:C, 7eti:A, 7eti:B, 7eti:C |
5 | 2vwt:A | 256 | 248 | 0.3254 | 0.3203 | 0.3306 | 3.46e-31 | 2vwt:B, 2vwt:C |
6 | 4tv5:A | 245 | 203 | 0.2738 | 0.2816 | 0.3399 | 2.12e-24 | 4tv6:A |
7 | 1izc:A | 299 | 246 | 0.2619 | 0.2207 | 0.2683 | 2.18e-11 | |
8 | 2b3d:A | 193 | 62 | 0.0794 | 0.1036 | 0.3226 | 0.011 | 2b3d:B |
9 | 1avf:J | 322 | 58 | 0.0714 | 0.0559 | 0.3103 | 0.45 | 1avf:A |
10 | 3rpe:A | 196 | 56 | 0.0675 | 0.0867 | 0.3036 | 1.7 | 3rpe:B |
11 | 7n4y:B | 2455 | 28 | 0.0556 | 0.0057 | 0.5000 | 2.1 | 7n4y:A |
12 | 1a3w:A | 492 | 77 | 0.0913 | 0.0467 | 0.2987 | 4.1 | 1a3w:B, 1a3x:A, 1a3x:B |
13 | 3b40:A | 400 | 44 | 0.0516 | 0.0325 | 0.2955 | 4.2 | |
14 | 4yng:E | 470 | 45 | 0.0595 | 0.0319 | 0.3333 | 4.5 | 8eq0:B, 8eq0:A, 4yng:A, 4yng:B, 4yng:C, 4yng:D, 4yng:F, 4yng:G, 4yng:H |
15 | 4utu:A | 229 | 102 | 0.0992 | 0.1092 | 0.2451 | 6.3 | 4utu:B, 4utw:A, 4utw:B, 4utw:C, 4utw:D |
16 | 3ju8:A | 486 | 50 | 0.0714 | 0.0370 | 0.3600 | 7.3 | 3ju8:B |