HHMKLVKTPLKDCYIIEPTVFEDERGYFYEKYNEKKFEELTGLNGHFVQDNISKSSYGVLRGLHLQKGKHAQAKLVSCLE
GRVWDVAVDLRENSETFGKCYGMELSAENKLQFYVPRGFAHGFVVLSETAVFSYKCDNFYNKESEGSVKFNDSDLSIDWK
IPEADMILSEKDQNAPAFKDKNY
The query sequence (length=183) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6c46:A | 183 | 183 | 1.0000 | 1.0000 | 1.0000 | 6.88e-138 | 6c46:D |
2 | 1dzt:A | 183 | 177 | 0.5301 | 0.5301 | 0.5480 | 6.94e-64 | 1dzt:B |
3 | 6ndr:A | 188 | 174 | 0.4973 | 0.4840 | 0.5230 | 4.59e-60 | 6ndr:B |
4 | 2ixh:A | 184 | 180 | 0.5082 | 0.5054 | 0.5167 | 4.61e-58 | 2ixh:B, 2ixi:B, 2ixi:A, 2ixk:A, 2ixk:B |
5 | 1epz:A | 183 | 178 | 0.4645 | 0.4645 | 0.4775 | 3.04e-55 | |
6 | 3ryk:A | 175 | 175 | 0.4262 | 0.4457 | 0.4457 | 1.21e-48 | 3ryk:B |
7 | 7pvi:AAA | 199 | 167 | 0.4262 | 0.3920 | 0.4671 | 2.82e-45 | 7pvi:BBB, 7pwb:AAA, 7pwb:BBB |
8 | 2ixc:A | 198 | 179 | 0.3661 | 0.3384 | 0.3743 | 1.28e-37 | 2ixc:B, 2ixc:C, 2ixc:D |
9 | 7pwh:AAA | 203 | 172 | 0.3279 | 0.2956 | 0.3488 | 5.67e-27 | |
10 | 5buv:A | 174 | 176 | 0.2842 | 0.2989 | 0.2955 | 4.00e-26 | 5buv:B |
11 | 4hn1:C | 201 | 162 | 0.2842 | 0.2587 | 0.3210 | 1.76e-24 | 4hmz:A, 4hmz:B, 4hmz:C, 4hmz:D, 4hn1:A, 4hn1:B, 4hn1:D |
12 | 8dcl:A | 185 | 166 | 0.3005 | 0.2973 | 0.3313 | 6.13e-24 | 7anj:A, 7anj:B, 8dak:A, 8dak:B, 8dcl:B |
13 | 1oi6:A | 202 | 159 | 0.2787 | 0.2525 | 0.3208 | 2.26e-21 | 1oi6:B |
14 | 8dco:B | 181 | 166 | 0.2842 | 0.2873 | 0.3133 | 1.41e-18 | 8db5:A, 8db5:B, 8db5:C, 8db5:D, 8db5:E, 8db5:F, 8db5:G, 8db5:H, 8dco:A |
15 | 7m15:D | 181 | 166 | 0.2842 | 0.2873 | 0.3133 | 2.25e-18 | 7an4:A, 7an4:B, 7an4:D, 7m14:A, 7m14:B, 7m14:C, 7m14:D, 7m14:E, 7m14:F, 7m15:A, 7m15:B, 7m15:C, 7m15:E, 7m15:F |
16 | 2ixl:C | 197 | 167 | 0.3279 | 0.3046 | 0.3593 | 4.84e-18 | 2ixl:A, 2ixl:B, 2ixl:D, 1nyw:A, 1nyw:B, 1nzc:A, 1nzc:B, 1nzc:C, 1nzc:D |
17 | 5o26:A | 273 | 49 | 0.0765 | 0.0513 | 0.2857 | 3.3 | 5o26:B, 5o2b:A |
18 | 5wch:A | 350 | 22 | 0.0601 | 0.0314 | 0.5000 | 5.3 | 5wch:B, 5wch:C, 5wch:D |
19 | 5epa:A | 258 | 48 | 0.0929 | 0.0659 | 0.3542 | 5.8 | 5epa:B, 5epa:C, 5epa:D, 5epa:E, 5epa:F |
20 | 5gll:A | 331 | 21 | 0.0546 | 0.0302 | 0.4762 | 6.1 | 5glk:B, 5glm:A, 5glm:B, 5gln:A, 5gln:B, 5glo:A, 5glo:B, 5glp:A, 5glp:B, 5glq:A, 5glq:B, 5glr:A, 5glr:B |
21 | 7qiy:O | 317 | 45 | 0.0820 | 0.0473 | 0.3333 | 6.9 | 8auv:Q, 8b2l:Q1, 7qiz:YA |
22 | 2w90:B | 471 | 48 | 0.0765 | 0.0297 | 0.2917 | 7.4 | 2w8z:A, 2w8z:B, 2w90:A |
23 | 4iaw:A | 180 | 75 | 0.1093 | 0.1111 | 0.2667 | 8.2 | 3dsz:A, 3dsz:B, 4iaw:B, 4iaw:C, 4iax:A |
24 | 6ol2:A | 279 | 49 | 0.0765 | 0.0502 | 0.2857 | 9.6 | 5drb:A, 8edh:A, 5o2b:B, 5tf9:A, 5tf9:B, 7uos:A, 5w7t:A, 5w7t:B, 5wdy:A, 5wdy:B, 5we8:A, 5we8:B |
25 | 3dje:B | 437 | 66 | 0.0929 | 0.0389 | 0.2576 | 9.8 | 3djd:A, 3djd:B, 3dje:A |