BioLiP

>protein
HHMKLLKIYLGEKDKHSGKPLFEYLVKRAYELGMKGVTVYRGIMGFGHPDLPIVLEIVDEEERINLFLKEIDNIDFDGLV
FTADVNVVK

The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1o51:A	89	89	1.0000	1.0000	1.0000	4.68e-60
2	2dcl:A	99	75	0.3820	0.3434	0.4533	6.64e-17	2dcl:C, 2dcl:B
3	2nog:A	157	44	0.1573	0.0892	0.3182	0.29	2nog:B
4	2fsh:A	691	24	0.1011	0.0130	0.3750	3.0	3bxz:A, 3bxz:B, 2fsg:A, 2fsi:A
5	2fsh:B	722	24	0.1011	0.0125	0.3750	3.1
6	2fsi:B	748	24	0.1011	0.0120	0.3750	3.1	2fsg:B
7	6s0k:h	838	24	0.1011	0.0107	0.3750	3.4	5k9t:A, 2vda:A
8	4aa1:A	598	29	0.1573	0.0234	0.4828	3.7	5a2r:A, 4aa2:A, 4asq:A, 4asr:A, 4ca7:A, 4ca8:A, 1j36:A, 1j36:B, 1j37:A, 1j37:B, 1j38:A, 1j38:B, 2x8y:A, 2x8z:A, 2x90:A, 2x91:A, 2x92:A, 2x93:A, 2x94:A, 2x95:A, 2x96:A, 2x97:A, 2xhm:A, 3zqz:A
9	3mbf:A	337	61	0.1910	0.0504	0.2787	5.0	3mbd:A, 3qrh:A
10	2x41:A	715	27	0.1348	0.0168	0.4444	6.7	2x42:A
11	6stt:A	178	53	0.1910	0.0955	0.3208	7.6	6stt:B
12	1d5a:A	733	38	0.1573	0.0191	0.3684	8.0
13	6br7:B	125	57	0.2135	0.1520	0.3333	8.3	6br7:A, 6vbf:A, 6vbf:B
14	7ktr:A	3042	21	0.1124	0.0033	0.4762	8.8
15	8xvg:L	3485	21	0.1124	0.0029	0.4762	8.8	8xvv:L
16	7mfp:B	354	26	0.1236	0.0311	0.4231	8.9	7mfo:A, 7mfo:B, 7mfo:C, 7mfo:D, 7mfo:E, 7mfo:F, 7mfo:G, 7mfo:H, 7mfo:I, 7mfo:J, 7mfp:A, 7mfp:C, 7mfp:D, 7mfq:A, 7mfq:B, 7mfq:C, 7mfq:D

[Back]