BioLiP

>protein
HHHHHDDLTDAELAADLAADAGKLLLQVRAEIGFDQPWTLGEAGDRQANSLLLRRLQAERPGDAVLSEEAHDDLARLKSD
RVWIIDPLDGTREFSTPGRDDWAVHIALWRRSPEITDAAVALPARGNVVYRTDTVTSVPGTLRIAVSATRPPAVLHRIRQ
TLAIQPVSIGSAGAKAMAVIDGYVDAYLHAGGQWEWDSAAPAGVMLAAGMHASRLDGSPLRYNQLDPYLPDLLMCRAEVA
PILLGAIADAWR

The query sequence (length=252) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5djj:A	257	258	0.9921	0.9728	0.9690	4.32e-176	5djg:A, 5djh:A, 5dji:A, 5djk:A
2	2wef:A	303	164	0.1825	0.1518	0.2805	2.02e-05	1jp4:A
3	2p3n:A	256	103	0.1151	0.1133	0.2816	2.08e-05	2p3n:B, 2p3n:C, 2p3n:D
4	5zon:A	256	64	0.1071	0.1055	0.4219	1.13e-04	5yht:A, 5yht:B, 5zon:B, 5zon:C, 5zon:D
5	6giu:A	275	234	0.2024	0.1855	0.2179	1.38e-04	4as4:A, 4as4:B, 1awb:A, 1awb:B, 6giu:B, 6gj0:A, 6gj0:B, 2hhm:A, 2hhm:B, 1ima:A, 1ima:B, 1imb:A, 1imb:B, 1imc:A, 1imc:B, 1imd:A, 1imd:B, 1ime:A, 1ime:B, 6zk0:AAA, 6zk0:BBB
6	4qxd:B	289	146	0.1548	0.1349	0.2671	2.36e-04	4qxd:A
7	5dw8:A	260	194	0.1786	0.1731	0.2320	2.69e-04	5dw8:B, 5j16:A, 5j16:B, 5j16:C, 5j16:D
8	2bji:A	274	87	0.0992	0.0912	0.2874	8.11e-04	2bji:B
9	3lv0:A	258	64	0.0952	0.0930	0.3750	0.001	3luz:A, 3lv0:B
10	5eq9:B	260	106	0.1190	0.1154	0.2830	0.002	5eq8:A, 5eq9:A, 5eq9:C, 5eq9:D, 5t3j:A
11	5eyg:B	265	195	0.1587	0.1509	0.2051	0.003	5eyg:A, 5eyh:A, 5eyh:B, 5f24:A, 5f24:B, 4g61:A, 4g61:B, 4i3e:A, 4i3e:B, 4i3y:A, 4i3y:B, 4i40:A, 4i40:B, 4ptk:A, 4ptk:B, 3ryd:A, 3ryd:C
12	8wdq:A	273	196	0.2183	0.2015	0.2806	0.006	8wdq:B
13	3luz:B	234	64	0.0952	0.1026	0.3750	0.019
14	6ib8:B	270	50	0.0635	0.0593	0.3200	0.021	6ib7:A, 6ib8:A, 2qfl:A, 6tqn:T, 6tqn:S, 6tqo:T, 6tqo:S
15	2czi:A	259	244	0.2381	0.2317	0.2459	0.031	2czh:B
16	5q0c:A	328	73	0.0833	0.0640	0.2877	0.058	5et6:A, 5et6:C, 5et6:B, 5et6:D, 4he0:A, 4he1:A, 4he2:A, 3ifa:A, 3ifa:B, 3ifa:C, 3ifa:D, 3ifc:A, 3ifc:B, 3ifc:C, 3ifc:D, 5k56:A, 5l0a:A, 5q0c:B, 5q0c:C, 5q0c:D, 5q0c:E, 5q0c:F, 5q0c:G, 5q0c:H
17	4as5:A	274	216	0.2024	0.1861	0.2361	0.066	4as5:B, 4as5:C, 4as5:D
18	5k55:A	290	49	0.0714	0.0621	0.3673	0.27	5et8:A
19	8f9y:A	352	220	0.2103	0.1506	0.2409	0.89
20	5cd4:F	363	132	0.1310	0.0909	0.2500	1.3	5cd4:B, 5cd4:C, 5cd4:D, 5cd4:E, 5cd4:G, 5cd4:N, 5cd4:O, 5cd4:P, 5cd4:Q, 5cd4:R, 5cd4:S, 5h9e:E, 5h9e:F, 5h9e:G, 5h9e:H, 5h9e:I, 5h9f:E, 5h9f:F, 5h9f:G, 5h9f:H, 5h9f:I, 4qyz:D, 4qyz:E, 4qyz:F, 4qyz:G, 4qyz:H, 4tvx:F, 4tvx:D, 4tvx:E, 4tvx:C, 4tvx:B, 4tvx:G, 4tvx:R, 4tvx:P, 4tvx:Q, 4tvx:O, 4tvx:N, 4tvx:S, 4u7u:E, 4u7u:F, 4u7u:G, 4u7u:H, 4u7u:I, 4u7u:J, 4u7u:Q, 4u7u:R, 4u7u:S, 4u7u:T, 4u7u:U, 4u7u:V
21	4qyz:I	256	132	0.1310	0.1289	0.2500	1.6
22	1k9y:A	354	46	0.0675	0.0480	0.3696	5.9	1k9z:A, 1ka0:A, 1ka1:A, 1qgx:A
23	1otw:A	255	41	0.0635	0.0627	0.3902	5.9	3hlx:A, 3hlx:D, 3hml:A, 3hml:B, 3hnh:A, 4ny7:A, 4ny7:B, 1otw:B
24	6sup:A	2128	86	0.0794	0.0094	0.2326	6.0
25	6c4m:C	418	54	0.0675	0.0407	0.3148	6.2

[Back]