HHHHHAMALTDRGMTYDLDPKDGSSAATKPVLEVTKKVFDTAADAAGQTVTVEFKVSGAEGKYATTGYHIYWDERLEVVA
TKTGAYAKKGAALEDSSLAKAENNGNGVFVASGADDDFGADGVMWTVELKVPADAKAGDVYPIDVAYQWDPSKGDLFTDN
KDSAQGKLMQAYFFTQGIKSSSNPSTDEYLVKANATYADGYIAIKAGEP
The query sequence (length=209) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4iu2:A | 209 | 209 | 1.0000 | 1.0000 | 1.0000 | 1.66e-153 | 8ajy:A, 8ajy:C, 4iu3:A |
2 | 1inp:A | 400 | 124 | 0.1627 | 0.0850 | 0.2742 | 0.021 | |
3 | 3in6:A | 147 | 66 | 0.1053 | 0.1497 | 0.3333 | 0.15 | 3in6:B |
4 | 7kir:A | 326 | 124 | 0.1579 | 0.1012 | 0.2661 | 0.20 | 7kio:A |
5 | 8pu1:B | 191 | 43 | 0.0670 | 0.0733 | 0.3256 | 1.9 | 8pu4:A, 8pu4:B, 8pu4:C |
6 | 5xsf:A | 209 | 141 | 0.1722 | 0.1722 | 0.2553 | 3.6 | |
7 | 4imm:A | 331 | 81 | 0.1148 | 0.0725 | 0.2963 | 8.4 | 4imm:B |
8 | 3gyd:B | 180 | 38 | 0.0670 | 0.0778 | 0.3684 | 9.4 | 3gyd:A |