HGYVSSPKSRVIQCKENGIENPTHPACIAAKAAGNGGLYTPQEVAVGGVRDNHDYYIPDGRLCSANRANLFGMDLARNDW
PATSVTPGAREFVWTNTAAHKTKYFRYYITPQGYDHSQPLRWSDLQLIHDSGPADQEWVSTHNVILPYRTGRHIIYSIWQ
RDWDRDAAEGFYQCIDVDFG
The query sequence (length=180) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5fjq:A | 180 | 180 | 1.0000 | 1.0000 | 1.0000 | 6.82e-137 | 5fjq:B, 5fjq:C |
2 | 7zjb:B | 181 | 185 | 0.4389 | 0.4365 | 0.4270 | 5.47e-41 | |
3 | 6if7:A | 183 | 186 | 0.4167 | 0.4098 | 0.4032 | 4.33e-35 | |
4 | 5opf:A | 194 | 198 | 0.3778 | 0.3505 | 0.3434 | 2.11e-22 | |
5 | 6twe:A | 172 | 188 | 0.3556 | 0.3721 | 0.3404 | 2.51e-19 | |
6 | 4oy7:A | 196 | 197 | 0.3778 | 0.3469 | 0.3452 | 4.91e-19 | 4oy7:B, 4oy7:C, 4oy7:D, 4oy7:E, 4oy7:F, 4oy7:G, 4oy7:H |
7 | 8rry:A | 170 | 189 | 0.3389 | 0.3588 | 0.3228 | 1.15e-18 | 8rry:B |
8 | 5wsz:A | 169 | 185 | 0.3278 | 0.3491 | 0.3189 | 2.03e-17 | 5wsz:B, 5wsz:C, 5wsz:D |
9 | 5iju:A | 178 | 188 | 0.3389 | 0.3427 | 0.3245 | 1.35e-16 | 5iju:B, 2yox:A, 2yox:B, 2yoy:A, 2yoy:B |
10 | 7okr:AAA | 192 | 193 | 0.2944 | 0.2760 | 0.2746 | 1.09e-15 | |
11 | 4oy6:A | 186 | 194 | 0.3167 | 0.3065 | 0.2938 | 2.69e-15 | 4oy8:A |
12 | 5uiz:A | 186 | 193 | 0.3167 | 0.3065 | 0.2953 | 6.32e-15 | |
13 | 5ftz:A | 172 | 189 | 0.3167 | 0.3314 | 0.3016 | 1.20e-12 | |
14 | 6rw7:A | 208 | 210 | 0.3278 | 0.2837 | 0.2810 | 7.94e-12 | |
15 | 4alc:A | 166 | 189 | 0.3000 | 0.3253 | 0.2857 | 1.09e-11 | 4ale:A, 4alq:A, 4alr:A, 4als:A, 4alt:A |
16 | 6t5z:A | 174 | 184 | 0.3000 | 0.3103 | 0.2935 | 2.66e-11 | 6t5z:B, 6t5z:C |
17 | 8gul:A | 464 | 185 | 0.3000 | 0.1164 | 0.2919 | 4.91e-11 | |
18 | 8gul:B | 361 | 185 | 0.3000 | 0.1496 | 0.2919 | 4.94e-11 | |
19 | 8cc3:A | 180 | 192 | 0.3333 | 0.3333 | 0.3125 | 9.68e-11 | 8cc3:B, 8cc5:A, 8cc5:B, 7pb6:A, 7pb6:B, 7pb7:A, 7pb7:B |
20 | 5l2v:A | 166 | 182 | 0.2667 | 0.2892 | 0.2637 | 7.09e-10 | 5l2v:B |
21 | 4yn2:A | 281 | 100 | 0.1667 | 0.1068 | 0.3000 | 3.98e-06 | |
22 | 4x27:A | 307 | 128 | 0.2000 | 0.1173 | 0.2812 | 1.16e-04 | 4x29:A |
23 | 5aa7:A | 142 | 180 | 0.2278 | 0.2887 | 0.2278 | 0.010 | 5aa7:B, 5vg0:A, 5vg0:B, 5vg1:A, 5vg1:B |
24 | 2e1z:A | 394 | 94 | 0.1500 | 0.0685 | 0.2872 | 0.46 | 2e20:A, 4fwk:A, 4fwm:A, 4fwn:A, 4fwo:A, 4fwp:A, 4fwq:A, 4fwr:A, 4fws:A, 1x3m:A, 1x3n:A, 4xh1:A, 4xh4:A, 4xh5:A |
25 | 8iew:A | 498 | 40 | 0.0611 | 0.0221 | 0.2750 | 1.4 | 8inb:A |
26 | 1jt2:A | 255 | 67 | 0.1056 | 0.0745 | 0.2836 | 1.6 | |
27 | 1xdn:A | 265 | 56 | 0.1000 | 0.0679 | 0.3214 | 1.8 | |
28 | 8tqm:A | 843 | 43 | 0.1111 | 0.0237 | 0.4651 | 3.0 | |
29 | 4tuf:A | 346 | 38 | 0.0722 | 0.0376 | 0.3421 | 3.6 | 4tuf:B, 4tuf:C, 4tuf:D |
30 | 6apl:C | 306 | 55 | 0.0944 | 0.0556 | 0.3091 | 4.8 | 6apl:A, 6apl:B, 6apl:D, 6apl:E, 6apl:F |