HGYVSSIQACGQTYPGADPHNPNPESPGWQAENTDLGFVEPSAFSTPAIACHKNARAPPAHATVQAGSTIKLTWNTWPES
HHGPVLDYIAPCNGDCSSASAGSLNFVKIAEKGLISGSNPGFWAADELIQNGNSWEVTIPANLAPGKYVLRHEIIALHSA
GNPNGAQAYPQCINLEVTGGGSATPSGQPATSFYSPNDPGILFNLYQSFDSYPIPGPAVW
The query sequence (length=220) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7ntl:A | 220 | 220 | 1.0000 | 1.0000 | 1.0000 | 2.10e-162 | |
| 2 | 7a8v:A | 230 | 226 | 0.5545 | 0.5304 | 0.5398 | 4.37e-84 | |
| 3 | 5x6a:A | 229 | 227 | 0.5727 | 0.5502 | 0.5551 | 8.06e-84 | 6h1z:A, 6h1z:B, 6ha5:A, 6ha5:B, 6haq:A, 6haq:B, 5x6a:B |
| 4 | 7ova:DDD | 231 | 226 | 0.5682 | 0.5411 | 0.5531 | 1.00e-83 | 7ova:AAA, 7ova:BBB, 7ova:CCC |
| 5 | 8b4g:AAA | 228 | 226 | 0.5545 | 0.5351 | 0.5398 | 1.60e-80 | 7pu1:AAA, 7pu1:BBB, 7pz3:A, 7pz4:A, 7pz5:A, 7pz6:A, 7pz7:A, 7pz8:A, 7q1k:A, 2yet:A, 2yet:B, 3zud:A |
| 6 | 5o2w:A | 248 | 225 | 0.5318 | 0.4718 | 0.5200 | 5.17e-73 | 5o2x:A |
| 7 | 7vfc:A | 228 | 227 | 0.5136 | 0.4956 | 0.4978 | 5.66e-71 | |
| 8 | 2vtc:A | 228 | 200 | 0.4409 | 0.4254 | 0.4850 | 6.52e-63 | 2vtc:B |
| 9 | 5nns:A | 225 | 230 | 0.4091 | 0.4000 | 0.3913 | 8.03e-43 | 5nns:B |
| 10 | 4eis:A | 225 | 227 | 0.4136 | 0.4044 | 0.4009 | 4.31e-38 | 4eis:B |
| 11 | 5nlt:B | 227 | 195 | 0.3318 | 0.3216 | 0.3744 | 5.91e-31 | 5nlt:A, 5nlt:C, 5nlt:D, 5nlt:E, 5nlt:F, 6ydc:A, 6ydc:B, 6ydc:C, 6ydc:D, 6ydd:A, 6ydd:B, 6yde:A, 6ydf:A, 6ydf:B |
| 12 | 4d7u:A | 227 | 152 | 0.3000 | 0.2907 | 0.4342 | 3.85e-28 | 4d7u:B, 4d7v:A, 4d7v:B |
| 13 | 5ufv:A | 228 | 234 | 0.3545 | 0.3421 | 0.3333 | 5.24e-28 | 5ufv:B, 5ufv:C, 5ufv:D, 5ufv:E, 5ufv:F |
| 14 | 5foh:A | 218 | 165 | 0.2636 | 0.2661 | 0.3515 | 1.42e-24 | |
| 15 | 4eir:A | 223 | 172 | 0.2636 | 0.2601 | 0.3372 | 3.63e-23 | 4eir:B, 7t5c:A, 7t5c:B, 7t5d:A, 7t5d:B, 7t5e:A, 7t5e:B, 5tkf:A, 5tkf:C, 5tkf:B, 5tkf:D, 5tkg:A, 5tkg:B, 5tkh:A, 5tkh:B, 5tki:A, 5tki:B |
| 16 | 8b7p:AAA | 213 | 180 | 0.3182 | 0.3286 | 0.3889 | 3.44e-22 | 8b7p:BBB, 8b7p:CCC, 8b7p:DDD |
| 17 | 5acf:A | 235 | 195 | 0.3227 | 0.3021 | 0.3641 | 3.93e-21 | 5acg:A, 5ach:A, 5aci:A, 5acj:A, 8e1w:A, 5n04:A, 5n05:A, 7nim:A, 7nin:A, 5nkw:A, 5nln:A, 5nlo:A, 5nlp:A, 5nlq:A, 5nlr:A, 5nls:A, 7pqr:A, 7ptz:AAA, 7pxi:A, 7pxj:A, 7pxk:A, 7pxl:A, 7pxm:A, 7pxn:A, 7pxr:A, 7pxs:A, 7pxt:A, 7pxu:A, 7pxv:A, 7pxw:A, 7pyd:A, 7pye:A, 7pyf:A, 7pyg:A, 7pyh:A, 7pyi:A, 7pyl:A, 7pym:A, 7pyn:A, 7pyo:A, 7pyp:A, 7pyq:A, 7pyu:A, 7pyw:A, 7pyx:A, 7pyy:A, 7pyz:A, 7pz0:A, 6ydg:A |
| 18 | 6rs6:A | 221 | 209 | 0.2818 | 0.2805 | 0.2967 | 9.80e-18 | 6rs9:A |
| 19 | 4b5q:A | 217 | 190 | 0.3091 | 0.3134 | 0.3579 | 1.18e-17 | 4b5q:B |
| 20 | 7exk:A | 217 | 187 | 0.3136 | 0.3180 | 0.3690 | 2.04e-17 | 7exk:B, 7exk:C, 7exk:D, 7exk:E, 7exk:F |
| 21 | 3eii:A | 208 | 199 | 0.3364 | 0.3558 | 0.3719 | 7.29e-17 | 3eii:B, 3eii:C, 3eii:D, 3eja:A, 3eja:B, 3eja:C, 3eja:D |
| 22 | 4qi8:A | 214 | 192 | 0.2909 | 0.2991 | 0.3333 | 1.65e-16 | 4qi8:B |
| 23 | 6z9l:A | 744 | 36 | 0.0636 | 0.0188 | 0.3889 | 3.6 | 6z9k:A, 6z9k:B |
| 24 | 7p04:A | 1353 | 57 | 0.0773 | 0.0126 | 0.2982 | 5.3 | 7p05:A |
| 25 | 7p06:A | 1350 | 57 | 0.0773 | 0.0126 | 0.2982 | 5.5 | |
| 26 | 4mai:A | 187 | 49 | 0.0818 | 0.0963 | 0.3673 | 6.0 | 4mah:A |
| 27 | 8dku:A | 395 | 56 | 0.0909 | 0.0506 | 0.3571 | 7.4 | 8dky:A, 8dky:B, 8dn8:A, 8dn8:C, 8dnc:A, 8dne:A, 8dne:C, 8dou:A, 8dou:C, 7k2t:A, 7k2t:C, 6m96:A |
| 28 | 4v6w:Az | 837 | 27 | 0.0500 | 0.0131 | 0.4074 | 8.8 |
umich.edu