BioLiP

>protein
HGFVSGIVADGSYYGGYNTDEYPYMSNPPNVIAWSTTATNCGFTNGTGYQSPDIICHSNASNGSNTAVVAAGSSIQFQWT
VWPASHHGPLITYLAPCGGNCATVDKTTLDFTKIAAVGLVNGVSPPGVWADDSMIADNNTAVVVIPASYAPGNYVLRHEI
IALHVAGNNNGAQNYPQCFNIQITGGGSAQGSGVAGTSLYKNTDPGIKFNIYSDLSGGYPIPGPALFA

The query sequence (length=228) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7vfc:A	228	228	1.0000	1.0000	1.0000	1.22e-166
2	5x6a:A	229	227	0.8289	0.8253	0.8326	1.92e-140	6h1z:A, 6h1z:B, 6ha5:A, 6ha5:B, 6haq:A, 6haq:B, 5x6a:B
3	8b4g:AAA	228	227	0.6360	0.6360	0.6388	2.52e-104	7pu1:AAA, 7pu1:BBB, 7pz3:A, 7pz4:A, 7pz5:A, 7pz6:A, 7pz7:A, 7pz8:A, 7q1k:A, 2yet:A, 2yet:B, 3zud:A
4	7ova:DDD	231	228	0.6053	0.5974	0.6053	1.34e-101	7ova:AAA, 7ova:BBB, 7ova:CCC
5	7a8v:A	230	228	0.5833	0.5783	0.5833	1.20e-93
6	5o2w:A	248	228	0.5482	0.5040	0.5482	2.05e-81	5o2x:A
7	7ntl:A	220	227	0.4956	0.5136	0.4978	5.86e-71
8	2vtc:A	228	233	0.4561	0.4561	0.4464	5.73e-57	2vtc:B
9	5nns:A	225	182	0.3289	0.3333	0.4121	2.50e-35	5nns:B
10	4eis:A	225	232	0.3728	0.3778	0.3664	4.90e-35	4eis:B
11	4d7u:A	227	202	0.3553	0.3568	0.4010	1.48e-29	4d7u:B, 4d7v:A, 4d7v:B
12	4eir:A	223	196	0.2895	0.2960	0.3367	4.11e-21	4eir:B, 7t5c:A, 7t5c:B, 7t5d:A, 7t5d:B, 7t5e:A, 7t5e:B, 5tkf:A, 5tkf:C, 5tkf:B, 5tkf:D, 5tkg:A, 5tkg:B, 5tkh:A, 5tkh:B, 5tki:A, 5tki:B
13	5ufv:A	228	173	0.2500	0.2500	0.3295	1.90e-20	5ufv:B, 5ufv:C, 5ufv:D, 5ufv:E, 5ufv:F
14	5foh:A	218	199	0.3026	0.3165	0.3467	6.46e-20
15	8b7p:AAA	213	183	0.2982	0.3192	0.3716	8.10e-19	8b7p:BBB, 8b7p:CCC, 8b7p:DDD
16	5nlt:B	227	196	0.2675	0.2687	0.3112	8.19e-19	5nlt:A, 5nlt:C, 5nlt:D, 5nlt:E, 5nlt:F, 6ydc:A, 6ydc:B, 6ydc:C, 6ydc:D, 6ydd:A, 6ydd:B, 6yde:A, 6ydf:A, 6ydf:B
17	5acf:A	235	244	0.3289	0.3191	0.3074	1.79e-16	5acg:A, 5ach:A, 5aci:A, 5acj:A, 8e1w:A, 5n04:A, 5n05:A, 7nim:A, 7nin:A, 5nkw:A, 5nln:A, 5nlo:A, 5nlp:A, 5nlq:A, 5nlr:A, 5nls:A, 7pqr:A, 7ptz:AAA, 7pxi:A, 7pxj:A, 7pxk:A, 7pxl:A, 7pxm:A, 7pxn:A, 7pxr:A, 7pxs:A, 7pxt:A, 7pxu:A, 7pxv:A, 7pxw:A, 7pyd:A, 7pye:A, 7pyf:A, 7pyg:A, 7pyh:A, 7pyi:A, 7pyl:A, 7pym:A, 7pyn:A, 7pyo:A, 7pyp:A, 7pyq:A, 7pyu:A, 7pyw:A, 7pyx:A, 7pyy:A, 7pyz:A, 7pz0:A, 6ydg:A
18	6rs6:A	221	197	0.2851	0.2941	0.3299	9.33e-15	6rs9:A
19	3eii:A	208	87	0.1754	0.1923	0.4598	4.16e-13	3eii:B, 3eii:C, 3eii:D, 3eja:A, 3eja:B, 3eja:C, 3eja:D
20	4qi8:A	214	195	0.2807	0.2991	0.3282	5.96e-12	4qi8:B
21	4b5q:A	217	202	0.2632	0.2765	0.2970	2.40e-10	4b5q:B
22	7exk:A	217	92	0.1667	0.1751	0.4130	3.22e-10	7exk:B, 7exk:C, 7exk:D, 7exk:E, 7exk:F
23	7qbu:A	418	51	0.0658	0.0359	0.2941	1.4	7qbs:A, 7qbt:A, 7qbt:B, 7qbt:C, 7qbt:D, 7qbu:B, 7qbv:A, 7qbv:B, 7qbv:C, 7qbv:D
24	4f6o:A	268	62	0.0789	0.0672	0.2903	5.6	4f6p:A
25	1fc4:A	401	64	0.0789	0.0449	0.2812	7.5	1fc4:B

[Back]