HGEKSQQAFLRMRTLNWYDVKWSKTSLNVNESMVLSGKVHVFSAWPQAVANPKSSFLNAGEPGPVLVRTAQFIGEQFAPR
The query sequence (length=362) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
3chx:A |
362 |
362 |
1.0000 |
1.0000 |
1.0000 |
0.0 |
3chx:E, 3chx:I |
2 |
4pi0:E |
390 |
387 |
0.8646 |
0.8026 |
0.8088 |
0.0 |
4phz:A, 4phz:E, 4phz:I, 4pi0:A, 4pi0:I, 4pi2:E, 4pi2:A, 4pi2:I, 3rfr:A, 3rfr:E, 3rfr:I, 7s4m:A, 7s4m:E, 7s4m:I |
3 |
7ev9:A |
382 |
382 |
0.4834 |
0.4581 |
0.4581 |
2.11e-113 |
7ev9:E, 7ev9:I, 8oyi:A, 8oyi:E, 8oyi:I, 3rgb:A, 3rgb:E, 3rgb:I, 7s4h:A, 7s4h:E, 7s4h:I, 7s4i:A, 7s4i:E, 7s4i:I, 7s4j:A, 7s4j:E, 7s4j:I, 7s4k:A, 7s4k:E, 7s4k:I, 8sqw:A, 8sqw:E, 8sqw:I, 8sr1:A, 8sr1:E, 8sr1:I, 8sr2:A, 8sr2:E, 8sr2:I, 8sr4:A, 8sr4:E, 8sr4:I, 8sr5:A, 8sr5:E, 8sr5:I, 7t4o:A, 7t4o:E, 7t4o:I, 7t4p:A, 7t4p:E, 7t4p:I, 1yew:A, 1yew:E, 1yew:I |
4 |
6cxh:A |
382 |
382 |
0.4779 |
0.4529 |
0.4529 |
3.81e-112 |
7s4l:A, 7s4l:D, 7s4l:E |
5 |
4o65:A |
153 |
44 |
0.0414 |
0.0980 |
0.3409 |
0.004 |
|
6 |
2yc3:A |
219 |
114 |
0.1050 |
0.1735 |
0.3333 |
1.9 |
5mrm:A, 5mro:A, 5mrp:A, 4nak:A, 4nal:A, 4nan:A, 1w77:A, 2yc5:A, 2ycm:A |
7 |
6hrg:A |
233 |
43 |
0.0442 |
0.0687 |
0.3721 |
2.4 |
|
8 |
5hqm:A |
459 |
70 |
0.0497 |
0.0392 |
0.2571 |
4.3 |
5han:A, 5han:B, 5han:C, 5han:D, 5han:E, 5han:F, 5han:G, 5han:H, 5han:I, 5han:J, 5han:K, 5han:L, 5hao:A, 5hao:B, 5hao:C, 5hao:D, 5hao:E, 5hao:F, 5hat:A, 5hat:B, 5hat:C, 5hat:D, 5hat:E, 5hat:F, 5hat:G, 5hat:H, 5hat:I, 5hat:J, 5hat:K, 5hat:L, 5hjx:A, 5hjx:B, 5hjx:C, 5hjx:D, 5hjx:E, 5hjx:F, 5hjy:A, 5hjy:B, 5hjy:C, 5hjy:D, 5hjy:E, 5hjy:F, 5hk4:A, 5hk4:B, 5hk4:C, 5hk4:D, 5hk4:E, 5hk4:F, 5hql:A, 5hql:B, 5hql:C, 5hql:D, 5hql:E, 5hql:F, 5hqm:B, 5koz:A, 5koz:B, 5koz:C, 5koz:D, 5koz:E, 5koz:F, 5koz:G, 5koz:H, 5koz:I, 5koz:J, 5koz:K, 5koz:L, 4lf1:A, 4lf1:B, 4lf1:C, 4lf1:D, 4lf1:E, 4lf1:F, 4lf2:A, 4lf2:C, 4lf2:D |
9 |
1t3q:B |
786 |
73 |
0.0580 |
0.0267 |
0.2877 |
5.5 |
1t3q:E |