HFFEGTEKLLEVWFSRQQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQEAYVLSE
The query sequence (length=58) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1jl0:B | 311 | 58 | 0.9828 | 0.1833 | 0.9828 | 1.08e-33 | 3dz2:B, 3dz2:A, 3dz3:B, 3dz3:A, 3dz4:B, 3dz4:A, 3dz5:B, 3dz5:A, 3dz6:B, 3dz6:A, 3dz7:B, 3dz7:A, 3ep3:A, 3ep4:A, 3ep5:A, 3ep6:B, 3ep6:A, 3ep7:B, 3ep7:A, 3ep8:B, 3ep8:A, 3ep9:A, 3epa:A, 3epb:A, 3h0v:B, 3h0v:A, 3h0w:B, 3h0w:A, 1i72:B, 1i72:A, 1i79:B, 1i79:A, 1i7b:B, 1i7b:A, 1i7c:A, 1i7c:B, 1i7m:A, 1i7m:B, 1i7m:C, 1i7m:D, 1jl0:A |
2 | 3fsr:A | 352 | 14 | 0.1552 | 0.0256 | 0.6429 | 4.9 | 3fsr:C, 3ftn:A, 3ftn:B, 3ftn:C, 3ftn:D |
3 | 6sch:C | 355 | 14 | 0.1552 | 0.0254 | 0.6429 | 5.0 | 2b83:A, 2b83:B, 2b83:C, 2b83:D, 1jqb:A, 1jqb:B, 1jqb:C, 1jqb:D, 1kev:A, 1kev:B, 1kev:C, 1kev:D, 1ped:A, 1ped:B, 1ped:C, 1ped:D, 6sch:A, 6sch:B, 6sch:D |
4 | 3fpc:A | 352 | 15 | 0.1552 | 0.0256 | 0.6000 | 5.6 | 3fpc:B, 3fpc:C, 3fpc:D |
5 | 2oui:A | 360 | 15 | 0.1552 | 0.0250 | 0.6000 | 5.6 | 2oui:B, 2oui:C, 2oui:D, 1y9a:A, 1y9a:C |