BioLiP

>protein
HDEIISELRELCLNYIEQDERLSRQKLNFLGQREPRMVLIEGLKLLSRCIEIDSADKSGCTHNHDDKSVETILVESGIVC
PGLPLIIPDGYKLIDNSLILLECFVRSTPASFEKKFIEDTNKLACIREDLAVAGVTLVPIVDGRCDYDNSFMPEWANFKF
RDLLFKLLEYSNQDEKVFEESEY

The query sequence (length=183) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7x6v:A	1381	182	0.9891	0.1311	0.9945	3.68e-121
2	7x6s:A	1453	182	0.9891	0.1246	0.9945	5.25e-121	5ltf:A, 5ltn:A, 5ltn:B, 5t2t:A
3	6klc:A	1436	182	0.5355	0.0682	0.5385	9.27e-63
4	7ela:A	1402	182	0.5355	0.0699	0.5385	1.36e-62
5	7ojn:L	2010	176	0.5410	0.0493	0.5625	1.50e-62	5j1n:A, 5j1p:A, 4miw:A, 7oe7:L
6	7ojj:L	1785	176	0.5410	0.0555	0.5625	1.80e-62
7	7oe3:L	1478	176	0.5410	0.0670	0.5625	2.27e-62	7oea:L, 7oeb:L
8	7ojk:L	1843	176	0.5410	0.0537	0.5625	2.28e-62
9	7ckl:A	1415	182	0.5191	0.0671	0.5220	3.20e-58
10	7elb:A	1937	178	0.4208	0.0398	0.4326	6.34e-44	7ckm:A, 7elb:C, 6kld:A, 6kle:A, 6klh:A, 6klh:C
11	7eju:A	1648	182	0.4208	0.0467	0.4231	7.44e-42
12	7el9:A	1731	174	0.3333	0.0352	0.3506	4.35e-21	7el9:D, 7elc:A
13	1vg0:A	481	42	0.0874	0.0333	0.3810	2.6
14	3pvs:D	424	54	0.0874	0.0377	0.2963	6.4	3pvs:A, 3pvs:B
15	5mpt:A	379	89	0.1475	0.0712	0.3034	6.6
16	4wjb:A	409	59	0.0874	0.0391	0.2712	7.0	4wjb:B, 4wjb:C, 4wjb:D
17	8y6o:U	458	76	0.1202	0.0480	0.2895	7.7	8h6e:4T, 8h6j:4T, 6qw6:U, 6qx9:U
18	7rr9:A	560	21	0.0437	0.0143	0.3810	8.3	7rr9:B, 7vx8:B, 7vx8:A
19	7x0z:B	580	21	0.0437	0.0138	0.3810	8.3	7shm:A, 7shm:B, 7x0z:A
20	7x07:A	633	21	0.0437	0.0126	0.3810	8.4	7shn:A, 7shn:B, 7vzb:A, 7vzb:B, 7x0t:A, 7x0t:B, 7x1w:A, 7x1w:B, 7xec:A, 7yrq:A, 7yrq:B

[Back]