BioLiP

>protein
HDAEVLDSIMDRLHEPLYEKDTFDPNEVLAENKQLYEEFLLQEISEPKVDNLVRSGDPLAGKAKGTILSLVRNSDLEDII
SSIQQLEEEYNKNFGYPYTFLNDEEFTDEFKDGIKSILPKDRVVEFGTIGPDNWNMPDSIDRERYDQEMDKMSEVESYHN
MCRFYSKEFYHHPLLSKYKYVWRLEPNVNFYCKINYDVFQFMNKNDKIYGFVLNLYDSPQTIETLWTSTMDFVEEHPNYL
NVNGAFAWLKDNSQNPKNYDYTQGYSTCHFWTNFEIVDLDFLRSEPYEKYMQYLEEKGGFYYERWGDAPVRSLALALFAD
KSSIHWFRDIGYHHTPYTNCPTCPADSDRCNGNCVPGKFTPWSDLDNQNCQATWIRHSMSEEELEMY

The query sequence (length=387) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5a07:A	395	394	1.0000	0.9797	0.9822	0.0	5a07:B, 5a08:B
2	7bop:C	372	352	0.3824	0.3978	0.4205	8.46e-101	7bop:A, 7bop:B, 7bop:D, 7bop:E, 7bop:F
3	1s4o:A	335	306	0.3333	0.3851	0.4216	3.73e-85	1s4o:B, 1s4p:A, 1s4p:B
4	2c1d:B	137	42	0.0413	0.1168	0.3810	0.23	2c1d:D, 2c1d:F, 2c1d:H
5	2wpw:A	328	64	0.0465	0.0549	0.2812	0.70	2wpw:B, 2wpw:C, 2wpw:D, 2wpx:A, 2wpx:B
6	1itq:A	369	83	0.0491	0.0515	0.2289	0.93	1itq:B, 1itu:A, 1itu:B
7	5h2u:A	266	194	0.0982	0.1429	0.1959	2.0	6cz3:A, 6cz4:A, 5da3:A, 5h2u:B, 5h2u:C, 5h2u:D
8	8c79:A	478	123	0.0827	0.0669	0.2602	2.4	8c79:B
9	6ky3:A	353	65	0.0517	0.0567	0.3077	8.0
10	7oui:H	60	37	0.0336	0.2167	0.3514	8.7	3jcu:H, 3jcu:h, 5mdx:H, 5mdx:h, 7oui:h
11	2g37:B	300	54	0.0388	0.0500	0.2778	8.9	2ekg:A, 2ekg:B, 2g37:A, 5m42:A

[Back]