HCRLDKSNFQQPYITNRTFMLAKEASLADQNTDVRLIGEKLFHGVSMSERCYLMKQVLQFTLEEVLFPQSDRFQPYMQEV
VPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
The query sequence (length=141) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3dgc:M | 141 | 141 | 1.0000 | 1.0000 | 1.0000 | 1.89e-104 | 1ykb:A |
2 | 2ilk:A | 155 | 104 | 0.1986 | 0.1806 | 0.2692 | 0.45 | |
3 | 8a22:BF | 370 | 43 | 0.1348 | 0.0514 | 0.4419 | 1.9 | 8apn:BF, 8apo:BF |
4 | 8asw:A | 1255 | 60 | 0.1206 | 0.0135 | 0.2833 | 4.0 | |
5 | 5e6u:A | 583 | 74 | 0.1631 | 0.0395 | 0.3108 | 5.7 | 5e6r:A, 5e6s:A, 5e6s:C, 5e6s:E |
6 | 3h4m:A | 261 | 119 | 0.1915 | 0.1034 | 0.2269 | 8.0 | 3h4m:B, 3h4m:C |
7 | 6b9e:B | 387 | 68 | 0.1631 | 0.0594 | 0.3382 | 8.4 | 6b9d:A, 6b9d:B, 3q5e:E, 3q5e:G |
8 | 7td5:F | 447 | 44 | 0.0993 | 0.0313 | 0.3182 | 8.5 | |
9 | 7cxz:A | 245 | 37 | 0.0922 | 0.0531 | 0.3514 | 9.2 | |
10 | 5a8w:D | 549 | 24 | 0.0709 | 0.0182 | 0.4167 | 9.7 | 5a8r:A, 5a8r:D, 5a8r:G, 5a8r:J, 5a8w:A, 5a8w:G, 5a8w:J |